Labshake search
Citations for Peprotech :
1201 - 1250 of 5674 citations for P N Nonylphenol 13C6 99% 100 Ug Ml In Methanol since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2023Quote: ... and 100 ng/mL of CX3CL1 (Fractalkine/ chemokine (C-X3-C motif) ligand 1) (Peprotech, Catalog No. 300-31) for up to 12 days.
-
bioRxiv - Cell Biology 2023Quote: ... were passaged and replated at a density of 100,000 cells cm-2 then treated with 10 ng/ml FGF2 (100-18B, PeproTech) and 10 μM SB431542 (S1067 ...
-
bioRxiv - Developmental Biology 2020Quote: ETV2-ECs and ETV2-SPI1-ECs were cultured on coverslips until day 12 of differentiation with VEGFA (50ng/ml) (cat. 100-20, Peprotech). BALB/c LSECs were cultured for 1.5-2 hours after isolation ...
-
bioRxiv - Immunology 2022Quote: ... we thawed cryopreserved TCRα/β-depleted BM fractions at 37°C and cultured them overnight in SFEM containing 100 ng/mL human stem cell factor (SCF, Peprotech), 100 ng/mL human Fms-related tyrosine kinase 3 (FLT3 ...
-
bioRxiv - Molecular Biology 2019Quote: ... MLO-Y4 cells were treated with the following reagents in serum-free media: 5 ng/ml TGFβ1 (Peprotech, 100-36E), 0.1 μM PGE2 (Sigma) ...
-
bioRxiv - Neuroscience 2020Quote: ... Medium was replaced on the next day by Neuronal Expansion-XF Medium supplemented with EGF (20 ng/ml; AF-100-15, Peprotech) and FGF (20 ng/ml ...
-
bioRxiv - Bioengineering 2020Quote: ... the iPSCs were first cultured in basal medium (RPMI-1640 with 2% B27) supplemented with 100 ng/ml Activin A (Peprotech) and 3 μM CHIR99021 for 3 days and then with 5 ng/ml bFGF ...
-
bioRxiv - Bioengineering 2021Quote: ... and vascular endothelial growth factor (VEGF) (Catalog No. 100-20, Recombinant Human VEGF165, Peprotech, Rocky Hill, NJ, 0.1 μg/mL). A mixture of heparin ...
-
bioRxiv - Bioengineering 2021Quote: Lyophilized 90 % PEGDMA microrods were loaded by resuspending ∼100,000 (100 k) microrod aliquots in 20 μL of 1 mg/mL recombinant human β-NGF (Peprotech) as described in the Protein loading of PEGDMA microrods section ...
-
bioRxiv - Biochemistry 2022Quote: ... HeLa cells at a plate confluence of 80% were treated for 10 min with 100 ng/mL animal-free recombinant human EGF (PeproTech) or Gibco™ distilled water (Thermo Fisher Scientific ...
-
bioRxiv - Molecular Biology 2022Quote: ... and cultured for 8 days in differentiation medium (DMEM F12, 10% KOSR, with 1% NEAA and 1% Glutamine) containing 100 ng/mL of HGF (Peprotech) and 1% DMSO (Sigma Aldrich) ...
-
bioRxiv - Molecular Biology 2022Quote: ... The isolated cells were cultured in RPMI medium supplemented with 20% (v/v) FBS and 100 ng/mL human recombinant IL-2 (Peprotech). Two days prior to transduction ...
-
bioRxiv - Neuroscience 2022Quote: ... in 100 μl embryoid body medium (10 mM ROCK inhibitor, 50 ng/mL BMP-4 (Peprotech; Cat. No. 120-05), 20 ng/mL SCF (Peprotech ...
-
bioRxiv - Immunology 2022Quote: ... cells were maintained in 24-well G-Rex plates (Wilson Wolf) in NK MACS media (Miltenyi Biotech) supplemented with human IL-2 (100 IU/mL, Peprotech) and human IL-15 (20 ng/mL ...
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Neuroscience 2020Quote: ... Expansion of the neural progenitor cells was carried out in Neural Expansion Media (NEM) which is composed of NBM supplemented with FGF (10ng/ml) (100-18C, Peprotech) and EGF (10ng/ml ...
-
bioRxiv - Immunology 2022Quote: Splenic T-cells from Ldlr-/- and T-AbcdkoLdlr-/- mice were isolated and stimulated with Mouse T-Activator CD3/CD28 Dynabeads (ratio beads to cells 1:2) in the presence of 100 U/mL IL-2 (Peprotech) and 5 ng/mL TGFβ1 (Peprotech ...
-
bioRxiv - Microbiology 2020Quote: ... On DIV 10 add 100% N2 medium plus recombinant human Brain Derived Neurotrophic Factor 10ng/ml (BDNF 450-02; Peprotech); Glial-Derived Neurotrophic Factor 10ng/ml (GDNF 450-10 ...
-
bioRxiv - Cancer Biology 2021Quote: ... and then cultured in CTS T Cell Expansion medium (Thermo) containing 10% FBS and 100 IU/ml human IL-2 (PeproTech). The CellTiter 96 MTS assay (Promega ...
-
bioRxiv - Cancer Biology 2019Quote: Transformation assay was performed by removing IL-3 through centrifugation and adding 50 ng/mL human HGF (Peprotech 100-39H). For proliferation assays cells were seeded in 96-well plates at 5,000 cells/well and the following day were exposed to crizotinib (Selleck Chemicals ...
-
bioRxiv - Immunology 2020Quote: Adherent PBMC monolayer was washed twice with HBSS and monocytes were differentiated into hMDMs for 5 days in RPMI 1640 containing 100 ng/mL macrophage colony-stimulating factor (M-CSF, PeproTech) and 10% foetal calf serum ...
-
bioRxiv - Cell Biology 2020Quote: ... lines were maintained in StemFiT AK02 media (Ajinomoto) supplemented with 100 ng/ml recombinant human basic fibroblast growth factor (bFGF, Peprotech) (hereafter F/A media ...
-
bioRxiv - Developmental Biology 2020Quote: ... treated with 5 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 1 ...
-
bioRxiv - Microbiology 2020Quote: ... which was also combined with 100 or 500 ng/ml of the receptor activator of the NF-κB ligand (RANKL; Peprotech) application to the basolateral media where indicated.
-
bioRxiv - Immunology 2021Quote: ... macrophages were either maintained in an unactivated M0 state or they were M1-activated with 100 ng/mL of IFNg (Peprotech) and 100 ng/mL of LPS (MilliporeSigma ...
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Immunology 2021Quote: ... Forty-eight hours later cells were lifted off the plates and cultures were supplemented with 100 U/ml recombinant human IL-2 (Peprotech). CFSE labeling for certain experiments was performed prior to seeding on tissue culture plates.
-
Neutralizing activity of broadly neutralizing anti-HIV-1 antibodies against primary African isolatesbioRxiv - Immunology 2020Quote: ... A total of 2×106 CD4+ T lymphocytes were activated using anti CD3/CD2/CD28 beads (Miltenyi) and cultured in the presence of 100 U/mL IL-2 (Peprotech) at 37 °C and 5% CO2 ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Developmental Biology 2022Quote: ... #D1-011) according to manufacturer instructions by supplementing with 200 ng/ml human recombinant Sonic Hedgehog (Peprotech, Cat. #100-45) from day 0-10 and passaging cells at day 0 ...
-
bioRxiv - Immunology 2022Quote: ... bone marrow cells harvested from femurs and tibias of 6–10-week-old control or EROS-/- mice were grown in complete RPMI medium supplemented with 100 ng/mL of M-CSF (Peprotech) for 3 days ...
-
bioRxiv - Developmental Biology 2022Quote: ... 150 μl of N2B27 medium supplemented with 100 ng/ml Activin A (QKine, Cambridge, UK) and 3 μM chiron (Peprotech) was added to each well ...
-
bioRxiv - Molecular Biology 2022Quote: ... Both SFEM II and our custom expansion media were supplemented with 100 ng/mL stem cell factor (Peprotech, 250-03), 40 ng/mL insulin-like growth factor (Peprotech ...
-
bioRxiv - Neuroscience 2023Quote: ... and plated onto 3 wells of a 6-well plate precoated with GFR Matrigel in N2B27 with 100ng/ml FGFb (100-18B, Peprotech) and 100ng/ml EGF (AF-100-15 ...
-
bioRxiv - Bioengineering 2023Quote: ... After gelation samples were submerged in IMR90 medium with/without 2 ng/mL TGF-β2 (100-35B; PeproTech, Cranbury, NJ). Cultures were monitored for loss of collagen adhesion and contraction of the gel for 21 d and survival was quantified as described above.
-
bioRxiv - Cell Biology 2023Quote: ... cells were either given fresh MC medium or cultured in basal MC medium (1% FBS) or in basal MC medium supplemented with 50ng/mL recombinant human VEGF-A165 (100-20; Peprotech) and culture for another 3 days.
-
bioRxiv - Immunology 2023Quote: ... HeLa-sia) at a ratio of 1:100 in complete RPMI medium supplemented with 10 ng/mL GM-CSF (PeproTech). Cancer cells were seeded at an initial concentration of 1×10e4 cells/mL and the same amount of medium supplemented with GM-CSF was added at day 4 of the experiment ...
-
bioRxiv - Immunology 2023Quote: ... The cells were washed and replated in complete RPMI 1640 medium with 100 U/ml IL-2 (PeproTech, 200-02) 48 hours later ...
-
bioRxiv - Genomics 2024Quote: ... Undifferentiated CD34+ cells were expanded for four days in prestimulation medium by adding 100 ng/ml stem cell factor (SCF; PeproTech), 100 ng/ml FLT3-ligand (PeproTech) ...
-
bioRxiv - Cancer Biology 2024Quote: ... and 100 nM Human EGF (Peprotech #AF-100-15-1mg). HeLa cells were routinely tested negative for Mycoplasma (Promega PK-CA20-700-20).
-
bioRxiv - Cancer Biology 2021Quote: ... (Peprotech, 100-18b) 20 ng/mL EGF (Peprotech ...
-
bioRxiv - Developmental Biology 2021Quote: ... and treated with 25 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 24 hours.
-
bioRxiv - Cell Biology 2022Quote: ... Cells were treated with either low-serum media or low-serum media supplemented with 20 ng/mL HGF (PeproTech, 100-39) or by standard culture media supplemented with Lomustine (Selleckchem ...
-
bioRxiv - Bioengineering 2020Quote: ... A Th2 microenvironment was induced by perfusing the vascular channel of the Airway Lung-Chips with 100 ng/mL of IL-13 (Peprotech, USA) for 7 days ...
-
bioRxiv - Biochemistry 2022Quote: ... purified cells were cultured in complete medium added with 100 ng/ml macrophage colony-stimulating factor (M-CSF) (Peprotech, Stockholm, Sweden) or 100 ng/ml granulocyte–macrophage colony-stimulating factor (GM-CSF ...
-
bioRxiv - Neuroscience 2019Quote: ... with 1% platelet-poor plasma-derived bovine serum (Biomedical Technologies 50-443-029) with 20 ng/mL bFGF (Peprotech 100-18B), and 10µM retinoic acid (RA ...
-
bioRxiv - Developmental Biology 2019Quote: ... Cells were then washed 2 times in PBS and replaced with medium containing fresh SB431542 or 5ng/mL TGFβ1 (Peprotech, 100-21C) or 10ng/mL Activin A (Sigma Aldrich ...
-
bioRxiv - Immunology 2020Quote: PBMCs were plated in 24-well plates at 2×106 cells per well with 100 IU/ml IL-2 (PeproTech, USA) in the complete medium ...
-
bioRxiv - Bioengineering 2023Quote: ... reprogramming was continued in E8 medium and from Day 6 to Day 18 in E7 medium (E6 medium, cat. A1516401, Thermo Fisher Scientific + 100ng ml-1 bFGF, cat. 100-18B, Peprotech). On Day 18 ...