Labshake search
Citations for Peprotech :
1201 - 1250 of 5672 citations for Monobenzyl Phthalate Unlabeled 100 Ug Ml In Methyl Tert Butyl Ether since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: Splenic T-cells from Ldlr-/- and T-AbcdkoLdlr-/- mice were isolated and stimulated with Mouse T-Activator CD3/CD28 Dynabeads (ratio beads to cells 1:2) in the presence of 100 U/mL IL-2 (Peprotech) and 5 ng/mL TGFβ1 (Peprotech ...
-
bioRxiv - Microbiology 2020Quote: ... On DIV 10 add 100% N2 medium plus recombinant human Brain Derived Neurotrophic Factor 10ng/ml (BDNF 450-02; Peprotech); Glial-Derived Neurotrophic Factor 10ng/ml (GDNF 450-10 ...
-
bioRxiv - Cancer Biology 2021Quote: ... and then cultured in CTS T Cell Expansion medium (Thermo) containing 10% FBS and 100 IU/ml human IL-2 (PeproTech). The CellTiter 96 MTS assay (Promega ...
-
bioRxiv - Cancer Biology 2019Quote: Transformation assay was performed by removing IL-3 through centrifugation and adding 50 ng/mL human HGF (Peprotech 100-39H). For proliferation assays cells were seeded in 96-well plates at 5,000 cells/well and the following day were exposed to crizotinib (Selleck Chemicals ...
-
bioRxiv - Immunology 2020Quote: Adherent PBMC monolayer was washed twice with HBSS and monocytes were differentiated into hMDMs for 5 days in RPMI 1640 containing 100 ng/mL macrophage colony-stimulating factor (M-CSF, PeproTech) and 10% foetal calf serum ...
-
bioRxiv - Cell Biology 2020Quote: ... lines were maintained in StemFiT AK02 media (Ajinomoto) supplemented with 100 ng/ml recombinant human basic fibroblast growth factor (bFGF, Peprotech) (hereafter F/A media ...
-
bioRxiv - Immunology 2021Quote: The differentiation of isolated monocytes into macrophages was performed in RPMI 1640 GlutaMAx medium with 10% FCS and 1% P/S containing 100 ng/mL macrophage colony-stimulating factor (M-CSF) (PeproTech) for 7 days ...
-
bioRxiv - Developmental Biology 2020Quote: ... treated with 5 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 1 ...
-
bioRxiv - Microbiology 2020Quote: ... which was also combined with 100 or 500 ng/ml of the receptor activator of the NF-κB ligand (RANKL; Peprotech) application to the basolateral media where indicated.
-
bioRxiv - Immunology 2021Quote: ... macrophages were either maintained in an unactivated M0 state or they were M1-activated with 100 ng/mL of IFNg (Peprotech) and 100 ng/mL of LPS (MilliporeSigma ...
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Immunology 2021Quote: ... Forty-eight hours later cells were lifted off the plates and cultures were supplemented with 100 U/ml recombinant human IL-2 (Peprotech). CFSE labeling for certain experiments was performed prior to seeding on tissue culture plates.
-
Neutralizing activity of broadly neutralizing anti-HIV-1 antibodies against primary African isolatesbioRxiv - Immunology 2020Quote: ... A total of 2×106 CD4+ T lymphocytes were activated using anti CD3/CD2/CD28 beads (Miltenyi) and cultured in the presence of 100 U/mL IL-2 (Peprotech) at 37 °C and 5% CO2 ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Developmental Biology 2022Quote: ... #D1-011) according to manufacturer instructions by supplementing with 200 ng/ml human recombinant Sonic Hedgehog (Peprotech, Cat. #100-45) from day 0-10 and passaging cells at day 0 ...
-
bioRxiv - Immunology 2022Quote: ... bone marrow cells harvested from femurs and tibias of 6–10-week-old control or EROS-/- mice were grown in complete RPMI medium supplemented with 100 ng/mL of M-CSF (Peprotech) for 3 days ...
-
bioRxiv - Developmental Biology 2022Quote: ... 150 μl of N2B27 medium supplemented with 100 ng/ml Activin A (QKine, Cambridge, UK) and 3 μM chiron (Peprotech) was added to each well ...
-
bioRxiv - Molecular Biology 2022Quote: ... Both SFEM II and our custom expansion media were supplemented with 100 ng/mL stem cell factor (Peprotech, 250-03), 40 ng/mL insulin-like growth factor (Peprotech ...
-
bioRxiv - Bioengineering 2023Quote: ... After gelation samples were submerged in IMR90 medium with/without 2 ng/mL TGF-β2 (100-35B; PeproTech, Cranbury, NJ). Cultures were monitored for loss of collagen adhesion and contraction of the gel for 21 d and survival was quantified as described above.
-
bioRxiv - Neuroscience 2023Quote: ... and plated onto 3 wells of a 6-well plate precoated with GFR Matrigel in N2B27 with 100ng/ml FGFb (100-18B, Peprotech) and 100ng/ml EGF (AF-100-15 ...
-
bioRxiv - Cell Biology 2023Quote: ... cells were either given fresh MC medium or cultured in basal MC medium (1% FBS) or in basal MC medium supplemented with 50ng/mL recombinant human VEGF-A165 (100-20; Peprotech) and culture for another 3 days.
-
bioRxiv - Immunology 2023Quote: ... HeLa-sia) at a ratio of 1:100 in complete RPMI medium supplemented with 10 ng/mL GM-CSF (PeproTech). Cancer cells were seeded at an initial concentration of 1×10e4 cells/mL and the same amount of medium supplemented with GM-CSF was added at day 4 of the experiment ...
-
bioRxiv - Immunology 2023Quote: ... The cells were washed and replated in complete RPMI 1640 medium with 100 U/ml IL-2 (PeproTech, 200-02) 48 hours later ...
-
bioRxiv - Genomics 2024Quote: ... Undifferentiated CD34+ cells were expanded for four days in prestimulation medium by adding 100 ng/ml stem cell factor (SCF; PeproTech), 100 ng/ml FLT3-ligand (PeproTech) ...
-
bioRxiv - Cancer Biology 2024Quote: ... and 100 nM Human EGF (Peprotech #AF-100-15-1mg). HeLa cells were routinely tested negative for Mycoplasma (Promega PK-CA20-700-20).
-
bioRxiv - Cancer Biology 2021Quote: ... (Peprotech, 100-18b) 20 ng/mL EGF (Peprotech ...
-
bioRxiv - Developmental Biology 2021Quote: ... and treated with 25 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 24 hours.
-
bioRxiv - Cell Biology 2022Quote: ... Cells were treated with either low-serum media or low-serum media supplemented with 20 ng/mL HGF (PeproTech, 100-39) or by standard culture media supplemented with Lomustine (Selleckchem ...
-
bioRxiv - Bioengineering 2020Quote: ... A Th2 microenvironment was induced by perfusing the vascular channel of the Airway Lung-Chips with 100 ng/mL of IL-13 (Peprotech, USA) for 7 days ...
-
bioRxiv - Biochemistry 2022Quote: ... purified cells were cultured in complete medium added with 100 ng/ml macrophage colony-stimulating factor (M-CSF) (Peprotech, Stockholm, Sweden) or 100 ng/ml granulocyte–macrophage colony-stimulating factor (GM-CSF ...
-
bioRxiv - Neuroscience 2019Quote: ... with 1% platelet-poor plasma-derived bovine serum (Biomedical Technologies 50-443-029) with 20 ng/mL bFGF (Peprotech 100-18B), and 10µM retinoic acid (RA ...
-
bioRxiv - Developmental Biology 2019Quote: ... Cells were then washed 2 times in PBS and replaced with medium containing fresh SB431542 or 5ng/mL TGFβ1 (Peprotech, 100-21C) or 10ng/mL Activin A (Sigma Aldrich ...
-
bioRxiv - Immunology 2020Quote: PBMCs were plated in 24-well plates at 2×106 cells per well with 100 IU/ml IL-2 (PeproTech, USA) in the complete medium ...
-
bioRxiv - Developmental Biology 2023Quote: ... The differentiation medium was composed of modified N2B27 medium supplemented with 50 ng/ml recombinant human FGF4 (Peprotech, 100-31-25), 1 μg/ml heparin (Sigma ...
-
bioRxiv - Biochemistry 2023Quote: ... 1% penicillin-streptomycin (P/S)) supplemented with 10-100 ng/mL recombinant murine fibroblast growth factor (Peprotech, Rocky Hill, NJ, USA). At passage 3 ...
-
bioRxiv - Bioengineering 2023Quote: ... reprogramming was continued in E8 medium and from Day 6 to Day 18 in E7 medium (E6 medium, cat. A1516401, Thermo Fisher Scientific + 100ng ml-1 bFGF, cat. 100-18B, Peprotech). On Day 18 ...
-
bioRxiv - Cancer Biology 2023Quote: ... Colonic organoids were cultured in organoid base medium further supplemented with 100 ng mL−1 murine WNT3A (mWNT3A, Peprotech 315-20), 50 ng mL−1 mEGF (Thermo PMG8041) ...
-
bioRxiv - Cell Biology 2023Quote: ... On day 3, medium was replaced with E6 supplemented with 50 ng/mL vascular endothelial growth factor (VEGF, (PeproTech, 100-20), 10 ng/mL FGF2 and 20 ng/mL rBMP4 ...
-
bioRxiv - Bioengineering 2023Quote: ... cells were differentiated at a concentration of 5 x 105 cells/mL with 100 nM phorbol 12-myristate 13-acetate (PMA, PeproTech, 1652981) in complete RPMI media for 24 hours followed by 3 days of resting in complete RPMI media ...
-
bioRxiv - Cancer Biology 2024Quote: ... 5 x 105 splenocytes from single cell suspensions were incubated with increasing concentrations of recombinant mouse IFNγ (0, 0.1, 1, 10, 100 ng/mL) for 48 hours (Peprotech, 315-05). Cells were then harvested and incubated with a panel of antibodies containing anti-mouse CD19 (Biolegend,115504) ...
-
bioRxiv - Cell Biology 2024Quote: ... Macrophage precursors were added to the NPC culture in 1:1 neural maintenance medium:microglia medium ((DMEM-F12+Glutamax, 100 ng/mL M-CSF (Peprotech, 300-25), 100 ng/mL IL-34 (Peprotech ...
-
bioRxiv - Cancer Biology 2022Quote: ... EGF (100-47) and bFGF (100-18B) were purchased from PeproTech, London ...
-
bioRxiv - Cell Biology 2022Quote: ... Medium in the lower chamber was either serum-free medium or serum-free medium supplemented with 20 ng/ml HGF (PeproTech, 100-39). Transwell migration was allowed for 18 hours ...
-
bioRxiv - Cell Biology 2022Quote: ... and media were replaced with either pre-warmed SFM or pre-warmed SFM supplemented with 20 ng/mL HGF (PeproTech, 100-39) for 30 min ...
-
bioRxiv - Cell Biology 2019Quote: ... medium is made with DMEM/F12 together with the following components: 100 ng/mL Fetal Growth Factor-2 (FGF2 Peprotech #450-33), 100 ng/mL Epidermal Growth factor (EGF ...
-
bioRxiv - Cell Biology 2021Quote: ... Cells were deprived of serum for 2h and stimulated with 2 ng/ml of recombinant human EGF (Peprotech; Catalog #AF-100-15) for 2 ...
-
bioRxiv - Bioengineering 2020Quote: ... Primary human T cells were cultured in complete RPMI 1640 supplemented with 100 U/mL recombinant human IL-2 (PeproTech, 200-02). Cells were cultured at 37°C in a humidified 5% CO2 incubator.
-
bioRxiv - Bioengineering 2021Quote: ... HepatoSTIM™ medium was supplemented with 10 ng mL−1 of recombinant human TGF-β1 (100-21; PeproTech®, Rocky Hill, NJ), 100 ng mL−1 of recombinant human GDF-15 (120-28C ...
-
bioRxiv - Immunology 2021Quote: ... cells were starved for 6 hours in fresh media lacking cytokines and subsequently treated with 100 U/mL of either IL-2 or IL-15 (PeproTech 200-15).