Labshake search
Citations for Peprotech :
1201 - 1250 of 1402 citations for L lactate dehydrogenase B chain LDH B Human His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2021Quote: ... For TH17 cell differentiation, IL-6 (eBioscience, 20 ng/mL) and human TGF-β1 (Peprotech, 0.3 ng/mL) were added ...
-
bioRxiv - Immunology 2021Quote: ... Inducers of neutrophil chemotaxis were added to the bottom well in 600 µL of RPMI-1640 media containing 1,000 or 50,000 pg of recombinant human (rh-) IL-8 (PeproTech) or A549 cells culture previously infected for 48 hours with mock or ZIKV PE243 (1 MOI) ...
-
bioRxiv - Bioengineering 2022Quote: ... 1 ng/mL recombinant human fibroblast growth factor (FGF-basic 154 a.a., PeproTech #100-18B, Cranbury, NJ, USA), 20 mM HEPES pH 7.4 (Sigma Aldrich #H4034 ...
-
bioRxiv - Immunology 2022Quote: ... Approximately 2.5×105 TDM and MDM were stimulated with recombinant human IL-6 (200 or 2000 pg, Peprotech) for 24 hours at 37ºC and 5% CO2 ...
-
bioRxiv - Immunology 2022Quote: ... which were cultured in complete PRMI 1640-1% human serum supplemented with 1000 IU/ml GM-CSF (PeproTech) and 500 IU/ml IL-4 (PeproTech) ...
-
bioRxiv - Immunology 2023Quote: ... and expanded in RPMI 1640 containing 10% FBS and 100 IU/mL of recombinant human IL-2 (Peprotech). Human blood samples were enriched for T cells using negative bead selection (StemCell ...
-
bioRxiv - Bioengineering 2024Quote: ... 20 ng/mL interleukin-4 (IL-4) and 50 ng/mL recombinant human M-CSF (Peprotech EC Ltd.) were added to the culture media for 24 hours ...
-
bioRxiv - Cell Biology 2024Quote: ... China) supplemented with 50 ng/mL recombinant human fibroblast growth factor 10 (FGF-10; 100-26, PeproTech, USA), 3 μM CHR99021 (SML1046 ...
-
bioRxiv - Immunology 2022Quote: ... seeded at a density of 0.5×106/mL and stimulated with 0.5 or 25 ng/ml recombinant human IL-15 (PeproTech,). After an overnight period ...
-
bioRxiv - Cell Biology 2023Quote: ... The media was then replaced with that containing 10ng/ml human TNF-α (300-01A, Peprotech, London, UK), vehicle control ...
-
bioRxiv - Cancer Biology 2023Quote: ... containing human embryonic stem cell (hESC) medium supplemented with 4 ng/ml bFGF (PeproTech, AF-100-18B-50) and 50 µM Rho-associated protein kinase (ROCK ...
-
bioRxiv - Molecular Biology 2024Quote: ... 0.2 μg/mL recombinant human relaxin-2 in 0.1% BSA-PBS (Rln, R; Peprotech, Rocky Hill, NJ, USA) and a combination of E+R for the specified amount of time ...
-
bioRxiv - Cell Biology 2024Quote: ... The medium was then switched to cR-1 (N2B27 + 1 μM PD0325901, 20 ng/ml human LIF (Peprotech), and 0.75–1.0 mM valproic acid sodium salt (VPA ...
-
bioRxiv - Immunology 2024Quote: Human TNF-α was quantified in cell supernatants using a commercially available ELISA kit from PeproTech (900-TM25) and the appropriate commercial buffers (TMB ELISA Buffer Kit ...
-
bioRxiv - Cell Biology 2024Quote: ... EGF stimulation was obtained with 10 ng/ml of animal-free recombinant human EGF (Peprotech AF-100-15) for 3h ...
-
bioRxiv - Neuroscience 2022Quote: To obtain neural rosettes the EBs were seeded on poly-l-ornithine/laminin (POLAM) coated plates with PN medium supplemented with Noggin (200ng/ml; Peprotech) and SB431542 (10 μM ...
-
bioRxiv - Systems Biology 2019Quote: ... All in vitro T cell generation cultures were supplemented with 5ng/mL Flt3-L and 5 ng/mL IL-7 (Peprotech), and were sorted after 6 or 7 total days of culture before transducing with retroviral vectors or treating with small molecule inhibitors ...
-
Combining LSD1 and JAK-STAT inhibition targets Down syndrome-associated myeloid leukemia at its corebioRxiv - Cancer Biology 2022Quote: ... and a cytokine cocktail (FLT3-L, SCF, IL-6, IL-3, TPO; all purchased from PeproTech, Rocky Hill, NJ, USA). Samples were taken from pediatric AML patients treated as part of the AML Berlin-Frankfurt-Münster study group ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2023Quote: ... and cultured in complete RPMI 1640 media (10% fetal bovine serum, 1% penicillin-streptomycin, 1% L-glutamine) supplemented with 10 ng/mL M-CSF (PeproTech). Cells were cultured for 5 days at 37°C in a humidified 5% CO2 atmosphere under continuous high-dose 100 ng/mL lipopolysaccharide (LPS ...
-
bioRxiv - Cell Biology 2023Quote: ... glutamine and human early-acting cytokines (SCF 300 ng/ml, Flt3-L 300 ng/ml, TPO 100 ng/ml, and IL-3 60 ng/ml; all purchased from Peprotech). All cultures were kept at 37°C in a 5% CO2 water jacket incubator (Thermo Scientific ...
-
bioRxiv - Neuroscience 2024Quote: ... and replated at 50000-75000 cells/cm2 in a poly-L-ornithin-laminin coated 6-well plate with neurobasal medium supplemented with 10 ng/ml PDGFaa (Peprotech), 10 ng/ml IGF1 (Peprotech) ...
-
bioRxiv - Developmental Biology 2024Quote: ... All in vitro T cell generation cultures were supplemented with 5ng/mL Flt3-L and 5 ng/mL IL-7 (Peprotech). Experiments involving in vitro generation of NK and ILC populations (Figures 3 ...
-
bioRxiv - Immunology 2024Quote: ... filtered and cultured for 7 days in complete RPMI medium (RPMI-1640 medium containing L-glutamine plus 10% fetal calf serum) containing 20ng/mL recombinant GM-CSF (Peprotech).
-
bioRxiv - Cancer Biology 2021Quote: ... Recombinant IFN-γ (300-02) and anti-human IFN-γ antibody (506532) were purchased from PeproTech (Rocky Hill, USA). Etoposide (HY-13629 ...
-
bioRxiv - Developmental Biology 2020Quote: Small molecules and cytokines were supplemented as indicated in screening related figure legends: recombinant human BMP4 (10ng/ml, Peprotech), BMPRi (LDN193189 0.3µM ...
-
bioRxiv - Developmental Biology 2020Quote: ... or C57BL6/129sJae EpiSC line (derived following in vitro priming of V6.5 mouse ESCs) were expanded in N2B27 with 12ng/ml recombinant human bFGF (Peprotech) and 20ng/ml recombinant Human ACTIVIN A (Peprotech) ...
-
bioRxiv - Genomics 2020Quote: ... cells were assessed with and without 16h pretreatment of 10 ng/ml recombinant human IFNγ (Peprotech, Rocky Hill, NJ).
-
bioRxiv - Cell Biology 2019Quote: ... This medium was further supplemented with vitamins and minerals (Table 4), thyroxine (Whitney et al., 2018) and recombinant human TGFβ1 (Peprotech). Medium sampling ...
-
bioRxiv - Biochemistry 2020Quote: ... according to the manufacturer’s instructions and cultured in RPMI supplemented with 10% FBS and 30 U/ml recombinant human IL-2 (PeproTech) at 37°C in 5% CO2 ...
-
bioRxiv - Cancer Biology 2022Quote: ... with sorted autologous TFH cells (at a 1:1 ratio) or TFH mimicking signals (including 0.02 μg/mL recombinant human IL-4, Peprotech; 0.05 μg/ml recombinant human IL-21 ...
-
bioRxiv - Biochemistry 2022Quote: ... lung organoids were cultured in medium including recombinant human transforming growth factor (TGF)-β1 (Peprotech, Rocky Hill, NJ, USA) without A83-01 (Tocris ...
-
Variation in Leishmania chemokine suppression driven by diversification of the GP63 virulence factorbioRxiv - Microbiology 2021Quote: ... normalized live parasites (1×106) or heterologously expressed GP63 was incubated with 500pg/ml of human recombinant CXCL10 (Peprotech) for the indicated time at 37°C ...
-
bioRxiv - Immunology 2021Quote: ... Switzerland) for 11 days in the human plasma serum-containing medium with 3000 IU/ml of IL-2 (PeproTech). The cell cultures were supplemented with fresh media and IL-2 every 2–4 days ...
-
bioRxiv - Biochemistry 2021Quote: ... they were cultured in the presence of 0.5% FBS for the last 24 h and then incubated with 100-ng/ml human EGF (PeproTech) at 37°C for 5 min.
-
bioRxiv - Neuroscience 2021Quote: ... organoids were also generated as described excepting the addition of 25ng/mL recombinant human PTN (Peprotech, CAT#: 450-15) into differentiation media for 7d.
-
bioRxiv - Immunology 2021Quote: ... at a bead to cell ratio of 3:1 and 1,000 U/mL of recombinant human IL-2 (Peprotech). Fresh IL-2 containing media was added every 48 h and Human T-activator CD3/CD28 Dynabeads were added again at day 7 and removed at day 15 of expansion ...
-
bioRxiv - Immunology 2020Quote: ... Cells were polarized into M1 macrophages by 20 h incubation with human interferon (IFN)-γ (PeproTech, 20 ng/mL) and ultrapure LPS (10 pg/mL ...
-
bioRxiv - Cell Biology 2022Quote: ... cells were exposed to different dose-course or time-course of human IL-22 (Peprotech, Rocky Hill, NJ, USA). In order to study the rescue effecting ...
-
bioRxiv - Genetics 2022Quote: ... clone 145-2C11, WEHI antibody facility), anti-CD28 (2μg/ml, clone 3751, WEHI antibody facility) and human IL-2 (Peprotech). CD8 T cell cultures contained 25μg/ml anti-mouse IL2 (clone S4B6 ...
-
bioRxiv - Immunology 2023Quote: ... at a density of 7.5×105 cells/ml in 2 ml complete media supplemented with 20 ng/ml recombinant human GM-CSF (Peprotech). The plates were incubated at 37°C in 5% CO2 ...
-
bioRxiv - Immunology 2024Quote: ... and seeded with target HCC cells at a ratio of 50:1 (E:T ratio) in the presence or absence of rIFNB (500 ng/mL human [Peprotech, Cranbury ...
-
bioRxiv - Bioengineering 2024Quote: ... SCF (20 ng/ml) and TPO (25 ng/ml) (all recombinant human, Peprotech, 300-19, 300-07, 300-18) (100% medium) ...
-
bioRxiv - Immunology 2024Quote: CD8 T cells from WT p14 or Irf5-/- p14 mice were isolated as described above and cultured with or without 1µg/ml gp33 peptide in complete RPMI medium supplemented with 2ng/ml recombinant human IL-2 (Peprotech). Cells were then collected at 6 or 24 hours after incubation and washed with PBS ...
-
bioRxiv - Bioengineering 2024Quote: ... naive primary human CD4+ T cells were cultured on-chip for 24 h with media spiked with 1.22 ng/mL of recombinant human CCL21 (Peprotech). Brightfield images were acquired using transmitted light in time series mode (1 image was collected every 30 sec for 10 cycles ...
-
bioRxiv - Microbiology 2022Quote: ... monocytes were differentiated into imDCs in the presence of human interleukin 4 (IL-4; 20ng/ml; PEPROTECH; 200-04) and human granulocyte-macrophage colony-stimulating factor (GM-CSF ...
-
bioRxiv - Neuroscience 2023Quote: MCP-1 levels secreted by organoids were assessed using the Human MCP-1 Standard TMB ELISA development kit (Peprotech) according to the manufacturer’s protocol ...
-
bioRxiv - Immunology 2023Quote: ... tumor suspension and PBMCs were thawed and plated with recombinant human IFNy at 200 ng/mL (Peprotech, #300-02) (only for tumor suspension ...
-
bioRxiv - Immunology 2023Quote: ... in the presence of 2mg/mlaCD28 (clone 37.51, WEHI antibody facility) and 100U/ml recombinant human IL-2 (Peprotech), in 96 well flat-bottom plates at 104 cells per well ...
-
bioRxiv - Neuroscience 2024Quote: ... The NB-B27-S included human ciliary neurotrophic factor (CNTF, 10 ng/mL, 1:1000, Peprotech, AF-450-13), glial-derived neurotrophic factor (GDNF ...