Labshake search
Citations for Peprotech :
1151 - 1200 of 1851 citations for ERK1 2 Rabbit Recombinant mAb since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2021Quote: ... and fibroblast growth factor 2 (FGF-2, 5 ng mL-1; PeproTech). Cells were passaged before reaching 90% confluency and the medium was changed every 2–3 days.
-
bioRxiv - Neuroscience 2022Quote: ... and 10 ng/ml human fibroblast growth factor-2 (FGF-2, Peprotech) to synchronize the cells to the early OPC stage ...
-
bioRxiv - Bioengineering 2021Quote: ... 50IU rhIL-2 (Peprotech) and P/S ...
-
bioRxiv - Neuroscience 2021Quote: ... murine IL-2 (Peprotech) (days 1-3 ...
-
bioRxiv - Neuroscience 2022Quote: ... and FGF-2 (Peprotech). The medium was refreshed every other day ...
-
bioRxiv - Immunology 2022Quote: ... mouse IL-2 (Peprotech), and human TGF-beta (Peprotech) ...
-
bioRxiv - Genetics 2023Quote: ... XAV939 (2 uM, PeproTech), LDN-193189 (100 nM ...
-
bioRxiv - Cancer Biology 2022Quote: ... and 200 U/ml interleukin 2 (IL-2; Peprotech, Rocky Hill, NJ, USA) for 4 days ...
-
bioRxiv - Immunology 2021Quote: ... for 4 days at 37°C in complete RPMI medium supplemented with 10 ng/mL recombinant mouse IL-5 (PeproTech) and 20 ng/mL IL-2 (402-ML R&D) ...
-
bioRxiv - Immunology 2021Quote: ... for 4 days at 37°C in complete RPMI medium supplemented with 10 ng/mL recombinant mouse IL-5 (PeproTech) and 20 ng/mL IL-2 (402-ML R&D) ...
-
bioRxiv - Neuroscience 2021Quote: ... The cells were re-suspended in DMEM/F12 complete medium containing 20 ng/mL recombinant murine FGF (PeproTech, 450-33), 20 ng/mL recombinant murine EGF (PeproTech ...
-
bioRxiv - Immunology 2022Quote: Cells were cultured in complete T cell media supplemented with 5 ng/mL each of recombinant human IL-7 and IL-15 (PeproTech) and 10 U/mL recombinant human IL-2 ...
-
bioRxiv - Immunology 2022Quote: Cells were cultured in complete T cell media supplemented with 5 ng/mL each of recombinant murine IL-7 and IL-15 (PeproTech). One day prior to activation of OT-I cells ...
-
bioRxiv - Immunology 2019Quote: Bone marrow-derived macrophages (BMDMs) were cultured in complete RPMI with recombinant human CSF-1 (50 ng/ml; PeproTech Inc.) for 6 days ...
-
bioRxiv - Biochemistry 2019Quote: ... CD14+ cells were differentiated in to macrophages using recombinant human granulocyte-macrophage colony-stimulating factor (200 ng/mL GM-CSF) and recombinant human interferon gamma (50 ng/ml IFNγ) (Peprotech) in standard tissue culture DMEM media containing fetal calf serum ...
-
bioRxiv - Neuroscience 2019Quote: ... or a combination of lipopolysaccharide (LPS, 100 ng/mL) and recombinant murine IFN□ (25 ng/mL, PeproTech, Rocky Hill, NJ). Concurrently ...
-
bioRxiv - Microbiology 2019Quote: ... Purified CD14+ monocytes were cultured in complete RPMI supplemented with 100ng/mL each of recombinant human IL-4 and GM-CSF (PeproTech) at a cell density of 2e6 cells/mL ...
-
bioRxiv - Cancer Biology 2021Quote: ... Cells were allowed to attach on coverslip for 1 h and then cells were incubated with murine recombinant CCL2 (Peprotech) for 5 h ...
-
bioRxiv - Cancer Biology 2020Quote: ... Differentiation of BM cells into DCs was carried out in low attachment 10 mm cell culture dish in presence of bone marrow-differentiation media in presence of recombinant murine Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) (Cat. 315-03, Peprotech) for 48 h ...
-
bioRxiv - Cancer Biology 2020Quote: ... Ba/F3 cells and Ba/F7 cells were maintained in medium supplemented with 10 ng/ml recombinant mouse interleukin 3 (IL3) and interleukin 7 (IL7) (PeproTech), respectively ...
-
bioRxiv - Bioengineering 2021Quote: ... and vascular endothelial growth factor (VEGF) (Catalog No. 100-20, Recombinant Human VEGF165, Peprotech, Rocky Hill, NJ, 0.1 μg/mL). A mixture of heparin ...
-
bioRxiv - Bioengineering 2021Quote: Lyophilized 90 % PEGDMA microrods were loaded by resuspending ∼100,000 (100 k) microrod aliquots in 20 μL of 1 mg/mL recombinant human β-NGF (Peprotech) as described in the Protein loading of PEGDMA microrods section ...
-
bioRxiv - Cell Biology 2020Quote: ... Enteroendocrine cell reporter organoids were derived from the proximal small intestine of Neurog3-RFP mice (expressing RFP under the Neurog3 promoter) and cultured as described above using recombinant murine Noggin (100ng/ml, Peprotech) and 10% R-Spondin conditioned medium ...
-
bioRxiv - Biochemistry 2022Quote: ... HeLa cells at a plate confluence of 80% were treated for 10 min with 100 ng/mL animal-free recombinant human EGF (PeproTech) or Gibco™ distilled water (Thermo Fisher Scientific ...
-
bioRxiv - Cancer Biology 2022Quote: PDAC cells were seeded in a 6-well plate and after 24 hours were treated with 10 ng/ml of recombinant TGF-β1 (rTGF-β1, Peprotech) either alone or in the presence of 80 μM of Vactosertib (Vacto ...
-
bioRxiv - Microbiology 2022Quote: ... 1 × 106 BlaER1 cells per well of a 6-well tissue culture plate were treated with 10 ng/ml human recombinant M-CSF and IL-3 (PeproTech) and 100 nM β-estradiol (Sigma-Aldrich ...
-
bioRxiv - Immunology 2022Quote: ... OT-I T cells were maintained inactivated in vitro (‘No TCR’ condition) with recombinant mouse IL-7 (Peprotech, 10ng/ml). For IL-2 replenishment experiments ...
-
bioRxiv - Neuroscience 2020Quote: Treatment of primary neurons - The primary neurons were treated with APOE from conditioned media or recombinant APOE protein (350-02, 350-04, Peprotech). For conditioned media treatment ...
-
bioRxiv - Microbiology 2020Quote: ... The cells were cultured in RPMI 1640 (Nissui) supplemented with 10% heat-inactivated calf serum (Biowest) and 1 ng/mL recombinant human interleukin 6 (IL-6, PeproTech). HeLa and 293T cells were cultured in DMEM (Nacalai tesque ...
-
bioRxiv - Immunology 2022Quote: ... the cells were supplemented with murine rIFN-γ (40 μg/ml) (Recombinant Murine IFN-γ, Catalog Number:315-05, Peprotech) or were kept unaltered ...
-
bioRxiv - Immunology 2022Quote: ... The BM cells per animal were resuspended in growth medium and cultured at 1-2 x 106 cells/mL on sterile 6-well plates for 9 days in the presence of 200ng/ml recombinant murine Flt3-Ligand (Peprotech). The BM cells were maintained at 37°C in 5% CO2 ...
-
bioRxiv - Physiology 2022Quote: ... NRK-49 cells whose culture medium was supplemented with 400pg/mL of recombinant human IL-1β (PeproTech, Cranbury, NJ, USA) and 1×10-7M Angiotensin II acetate human (Sigma) ...
-
bioRxiv - Cell Biology 2019Quote: ... monocytes were also conditioned in presence of 20 ng/mL M-CSF and 10 ng/mL recombinant human IL-10 (PeproTech) or 10 U/mL of IFNβ (Peprotech) ...
-
bioRxiv - Systems Biology 2020Quote: ... Cells were grown to at least 500,000 cells/mL before treatment with 20 ng/mL recombinant human tumor necrosis factor α (TNF) (Peprotech), 300 nM A-485 (Structural Genomics Consortium) ...
-
bioRxiv - Microbiology 2020Quote: ... On DIV 10 add 100% N2 medium plus recombinant human Brain Derived Neurotrophic Factor 10ng/ml (BDNF 450-02; Peprotech); Glial-Derived Neurotrophic Factor 10ng/ml (GDNF 450-10 ...
-
bioRxiv - Immunology 2019Quote: ... Differentiation was achieved with recombinant human GM-CSF (40 ng/mL) and human IL-4 (40ng/mL, both from PeproTech). After 5 days ...
-
bioRxiv - Microbiology 2019Quote: ... Purified CD14+ monocytes were cultured in complete RPMI supplemented with 100ng/mL each of recombinant human IL-4 and GM-CSF (PeproTech) at a cell density of 2e6 cells/mL ...
-
bioRxiv - Cell Biology 2021Quote: Primary mouse AT2 cells were isolated from homozygous H991A adult (mice 6-8 weeks) and cultured in BEGM plus 10% charcoal-stripped FBS and recombinant human KGF (10 ng/ml, Peprotech) on top of a thin substrate of 70% Cultrex (Trevigen)/30% rat tail collagen (Advanced Biomatrix ...
-
bioRxiv - Cell Biology 2020Quote: ... lines were maintained in StemFiT AK02 media (Ajinomoto) supplemented with 100 ng/ml recombinant human basic fibroblast growth factor (bFGF, Peprotech) (hereafter F/A media ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Developmental Biology 2020Quote: ... treated with 5 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 1 ...
-
bioRxiv - Cancer Biology 2021Quote: ... supplemented only with 100 ng/ml recombinant human stem cell factor (rhSCF, Milteny Biotech) and 30 ng/ml recombinant human interleukin 3 (rh IL-3, both Peprotech).
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
The skin environment controls local dendritic cell differentiation and function through innate IL-13bioRxiv - Immunology 2021Quote: ... were harvested and one million cells were resuspended in 1 mL of TCM in 24 wells plates and stimulated with recombinant mouse IL-13 (Peprotech) at a concentration of 100 ng/mL for 30 min at 37°C ...
-
bioRxiv - Microbiology 2021Quote: ... cells were treated with recombinant mouse IFNβ (1000 U/ml, Stratech) or IL-10 (250 ng/ml, catalogue 210-10 Peprotech) 3 h prior to collection for immunoblotting.
-
bioRxiv - Immunology 2020Quote: ... approximately 2 x 106 cells were then seeded per 100 mm plate in 10 ml of media containing 20 ng/ml of recombinant murine (rm) GM-CSF (Peprotech). On day 3 ...
-
bioRxiv - Immunology 2021Quote: ... or medium alone for 6 h or with murine recombinant Interleukin–4 (rIL-4, 20 ng/mL, PeproTech EC Ltd.) for 24 h and analysed for MΦ activation markers by flow cytometry.
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Cell Biology 2021Quote: ... bone marrows were cultured and in vitro differentiated in bone marrow differentiation medium containing 40 ng/ml recombinant murine M-CSF (PeproTech) as described before (Sun et al. ...
-
bioRxiv - Microbiology 2021Quote: ... the viral suspension was removed and replaced via 100 μL of NDM or NDM supplemented with 100 ng/mL of recombinant human IL-1β (200-01B, Peprotech), IL-6 (200-06 ...