Labshake search
Citations for Peprotech :
1001 - 1050 of 1413 citations for Tumor necrosis factor receptor superfamily member 3 LTBR Mouse HEK293 Fc since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: ... human Neurotrophin-3 NT3 (10 ng/ml, PeproTech), 1X NEAA (Non-essential amino acids) ...
-
bioRxiv - Neuroscience 2024Quote: ... 10 ng/mL NT-3 (Peprotech, #450-03). Plates were kept in the incubator at 37°C and 5% CO2 for at least 2 h to induce collagen gel formation.
-
bioRxiv - Cell Biology 2024Quote: ... 25 ng/mL IL-3 (Peprotech, 213-13), 1× Glutamax ...
-
bioRxiv - Microbiology 2020Quote: ... the PBMCs were cultured with the synthetic peptide mixture of SARS-CoV-2 at a concentration of 1μg/ml or DMSO in RPMI 1640 medium containing 10% FCS and 20 U/ml recombinant human IL-2 (Peprotech) for 7 days ...
-
bioRxiv - Cell Biology 2021Quote: ... the remaining one-third of the chamber was filled with complete RPMI 1640 supplemented with 10% FCS in the presence or absence of 0.6 μg/ml murine CCL19 (Peprotech, USA). The slowly diffusing CCL19-containing medium creates a CCL19 gradient that promotes BMDC migration towards the upper part of the chamber.
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2023Quote: ... mouse bone marrow was flushed and cultured for 2 days in stem cell medium (DMEM + 15% FCS + 25ng/ml SCF (PeproTech) + 10ng/ml IL-3 (PeproTech ...
-
bioRxiv - Cell Biology 2019Quote: ... medium is made with DMEM/F12 together with the following components: 100 ng/mL Fetal Growth Factor-2 (FGF2 Peprotech #450-33), 100 ng/mL Epidermal Growth factor (EGF ...
-
bioRxiv - Cell Biology 2020Quote: ... cells were plated in 10 cm diameter Petri dishes with 10 ng/mL macrophage colony-stimulating factor (M-CSF, PeproTech, London, UK) for 24 h ...
-
bioRxiv - Cancer Biology 2021Quote: ... 10% FBS) in the presence of macrophage colony stimulating factor (M-CSF) (30 ng/mL, #315-02, Peprotech, Rocky Hill, NJ, USA). After three days in culture ...
-
bioRxiv - Immunology 2019Quote: ... 50μM 2-ME and 10 ng/ml of recombinant murine granulocyte– macrophage colonystimulating factor (GM-CSF, PeproTech Inc., Rocky Hill, NJ, USA) for 7 days ...
-
bioRxiv - Bioengineering 2022Quote: ... Hydrogels were cultured in 48 well plates for 7 days and maintained in ECM with or without additional growth factors (± 100 ng/mL recombinant human VEGF165; PeproTech 100-20) and hormones ...
-
bioRxiv - Neuroscience 2022Quote: ... hNPCs were plated on poly-L-ornithine- and laminin-coated plates and were differentiated with growth media (without FGF-b) supplemented with 25ng/mL recombinant human glial-derived neurotrophic factor (GDNF; PeproTech US, NJ). Fifty percent of cell media were removed every three to four days and replaced with fresh GDNF supplemented media ...
-
bioRxiv - Neuroscience 2023Quote: ... L-glutamine and 1% Penicillin-Streptomycin (v/v) supplemented with CHIR-99021 (Stemgent, 0.5 μM) and brain derived neurotrophic factor (BDNF, PeproTech, 20 ng/ml). On the day in vitro 50 ...
-
bioRxiv - Immunology 2023Quote: ... 55 uM 2-mercaptoethanol and 20 ng/ml of recombinant murine granulocyte-macrophage colony-stimulating factor (PeproTech, Rocky Hill, NJ, United States)] at 1:5 apoptotic cancer cell to cDC1 ratio ...
-
bioRxiv - Microbiology 2023Quote: ... and 50 μM β-mercaptoethanol and differentiated with 20 ng/ml murine granulocyte-macrophage colony-stimulating factor (GM-CSF) (Peprotech, 315-03). BMDCs were stained for CD11c and analyzed by flow cytometry (LSR-Fortessa flow cytometer ...
-
bioRxiv - Bioengineering 2023Quote: ... OPCs were cultured using OPC maintenance/proliferation media (OMM) composed of N2B27 supplemented with 10ng/ml insulin-like growth factor (IGF-1; Peprotech, 100-11), 15ng/ml platelet-derived growth factor AA (PDGFaa ...
-
bioRxiv - Cell Biology 2023Quote: ... The medium was changed every day until day 8 when medium was replaced by E6 medium supplemented with 10 ng/mL human Platelet-Derived Growth Factor BB (PDGF-BB, PeproTech, 100-14B) and 2 ng/mL Recombinant Human Transforming Growth Factor-β1 (TGF-β1 ...
-
bioRxiv - Immunology 2023Quote: ... in the presence of 40 ng/ml of granulocyte-macrophage colony-stimulating factor (GM-CSF) and IL-4 (both from Peprotech or Biolegend). Cells were cultured in 24-well plates in DMEM (Gibco) ...
-
bioRxiv - Cancer Biology 2023Quote: ... unsorted bone marrow cells from Myc+/+ or MycT58A/T58Amice (25,000 cells/ml) were cultured in IMDM containing stem cell factor (SCF Peprotech, 50 ng/ml), IL-6 (Peprotech ...
-
bioRxiv - Cancer Biology 2024Quote: ... After inhibitor treatment spheroids were treated with a combination of growth factors or vehicle for 30 minutes before fixation in-situ: 100 nM Human IGF1 (Peprotech #100-11) and 100 nM Human EGF (Peprotech #AF-100-15-1mg) ...
-
bioRxiv - Cell Biology 2023Quote: ... BMMs were seeded at a density of 1.2 × 105 cells/well into 24-well culture plates and incubated in α-MEM (SH30265.01; Hyclone, Rockford, IL, USA) containing 20 ng/mL macrophage colony-stimulating factor (M-CSF) (300-25; PeproTech, Cranbury, NJ, USA). To induce osteoclast differentiation ...
-
bioRxiv - Immunology 2021Quote: ... Mouse recombinant IL-21 (PeproTech) was added to co-cultures at 10ng/ml ...
-
bioRxiv - Immunology 2021Quote: ... recombinant mouse IL-12 (Peprotech) and anti-IL-4 (BioXCell) ...
-
bioRxiv - Cell Biology 2021Quote: ... 10ng/mL mouse SCF (Peprotech) and 0.1% PVA (Sigma ...
-
bioRxiv - Cancer Biology 2022Quote: ... mouse SCF (20ng/µL, PeproTech), penicillin (100U/mL ...
-
bioRxiv - Cancer Biology 2022Quote: ... mouse IFN-γ from PeproTech; MRT68601 ...
-
bioRxiv - Immunology 2019Quote: ... bone marrow cells were plated at a density of 5×105 cells/mL in RPMI-1640 + 10% FCS + 100 U/mL penicillin/streptomycin + 1 mM β-mercaptoethanol (BM medium) with 20 ng/mL murine GM-CSF (Peprotech) and cultures in a humidified environment at 37°C and 5% CO2 ...
-
bioRxiv - Biophysics 2021Quote: ... EMT in all cells lines were induced by addition of 5ng/ml Targeted Growth Factor-β1 (TGFβ1) (Peprotech, catalog no. 100-21-10UG) for 48 hours62.
-
bioRxiv - Immunology 2022Quote: ... The CD34 cell purity was checked by FACS and cells were cultured in IMDM with 10% HI FBS supplemented with human cytokine and growth factor cocktail from Peprotech (hTPO (#300-18) (10 ng/ml) ...
-
bioRxiv - Cell Biology 2021Quote: The immature motor neurons were seeded on the cell imaging coverglasses in a low density (1.5×104 cells/cm2) and grown for 2 days in the fourth step medium supplemented with neurotrophic factor (NTF) cocktail: IGF1 (PeproTech, 10 ng/ml), CNTF (PeproTech ...
-
bioRxiv - Cell Biology 2021Quote: ... cells were treated for 4 days with 50 ng/mL of brain-derived growth factor (BDNF) (Peprotech, Rocky Hill, NJ, USA, #450-02B) in serum-depleted EMEM/F12 media supplemented with 1% pen/strep 88,89.
-
bioRxiv - Immunology 2020Quote: ... Isolated PBMC were washed with PBS and resuspended by RPMI-1640 which supplemented 50ng/ml recombinant human macrophage colony-stimulating factor (M-CSF) (AF-300-25-500, PeproTech, Cranbury, NJ, USA), then cultured at 37°C in 5% CO2 for 5 days to differentiate into human monocyte derived macrophages (hMDMs ...
-
bioRxiv - Neuroscience 2022Quote: ... 10k primary rat microglia were added to 20k DIV12 primary hippocampal neurons with 40 ng/mL of rat macrophage colony stimulating factor (MCSF) (Peprotech 400-28-100UG). At the time of plating ...
-
bioRxiv - Microbiology 2023Quote: ... 100 ⍰g/ml streptomycin and 50 ⍰M β-mercaptoethanol plus 20 ng/ml murine granulocyte-macrophage colony-stimulating factor (GM-CSF) (Peprotech, 315-03). On day 4 ...
-
bioRxiv - Cell Biology 2023Quote: ... neuromuscular co-cultured were gently covered with 2 mL of DM containing brain-derived neurotrophic factor (BDNF, 10 ng/mL, PeproTech 450-02-10μg) and glial cell-derived neurotrophic factor (GDNF ...
-
bioRxiv - Bioengineering 2022Quote: ... The supernatant was discarded and the cells were re-suspended in BMDM (the same supplemented DMEM used for nerve fibroblasts, further supplemented with macrophage colony stimulating factor [400-28, Peprotech; 50 ng/ml]). Cells were counted in a hemocytometer and seeded on 100 x 15 mm uncoated petri dishes (Sigma ...
-
bioRxiv - Bioengineering 2023Quote: ... NPSCs were expanded using NPSC proliferation media (NPM) composed of N2B27 supplemented with 20 ng/ml epidermal growth factor (EGF; Peprotech, AF-100-15), 20ng/ml basic fibroblast growth factor (bFGF ...
-
bioRxiv - Genetics 2023Quote: ... EB-derived neural rosettes were dissociated into single cells with Accutase for 5⍰min at 37°C and plated on Matrigel or polyornithine/laminin-coated plates in the NIM complete medium supplemented with FGF2 (101ng/mL) and epidermal growth factor (EGF) (10⍰ng/mL; PeproTech, Rocky Hill, NJ). Cells were expanded for several passages as a homogeneous population of NPCs.
-
bioRxiv - Developmental Biology 2024Quote: ... proteins were supplemented in Maturation media by dissolving Matrigel at 1% (v/v) containing human recombinant brain-derived neurotrophic factor (BDNF; PeproTech, AF-450-02). The aggregated cells were referred to as cerebral organoids from this stage onward and were allowed to further develop in maturation media until the experimental endpoints ...
-
bioRxiv - Immunology 2024Quote: ... and cultured in DC media (15% FBS, 1% A/A, 50µM α-MTG, 20ng/mL granulocyte-macrophage colony stimulating factor (GM-CSF; Peprotech cat#: 315-03)
-
bioRxiv - Neuroscience 2021Quote: ... 30 ng/mL NT-3 (Peprotech, Rocky Hill, NJ), and 1% insulin-transferrin-sodium selenite premix (ITS ...
-
bioRxiv - Molecular Biology 2020Quote: ... 1ng/mL IL-3 (PeproTech, Rocky Hill, NJ, USA), 3U/mL erythropoietin (eBiosciences ...
-
bioRxiv - Neuroscience 2021Quote: ... Rho-associated protein kinase inhibitor (3 uM; 1293823; PeproTech) was added to the media for 1 day post replating.
-
bioRxiv - Neuroscience 2020Quote: ... and IL-3 (10 ng/ml; all from Peprotech). Day 10 cells were harvested and FACsorted based on CD43 expression ...
-
bioRxiv - Cancer Biology 2022Quote: ... and 20 ng/ml IL-3 (Peprotech, London, UK). Cell lines were tested for Mycoplasma contamination using MycoSensor PCR Assay Kit (Agilent ...
-
bioRxiv - Neuroscience 2022Quote: ... 10 ng/ml NT-3 (10 ng/ml, PeproTech), mouse laminin (0.2 μg/ml ...