Labshake search
Citations for Peprotech :
51 - 100 of 1415 citations for Recombinant Mouse Cd99 Fc tagged since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2019Quote: ... 100 ng/mL mouse recombinant noggin (Peprotech, Rocky Hill, NJ, USA), 50 ng/mL human recombinant EGF (Peprotech ...
-
bioRxiv - Immunology 2022Quote: ... with or without recombinant mouse IL-12 (20 ng/ml; Peprotech) and recombinant mouse IL-18 (10ng/ml ...
-
bioRxiv - Immunology 2021Quote: ... additionally supplemented with recombinant mouse GM-CSF (10 ng/ml; Peprotech) at 37°C ...
-
bioRxiv - Cell Biology 2020Quote: ... and supplemented with recombinant mouse GM-CSF (10 ng/ml) (Peprotech). Loosely adherent cells were harvested after 6 or 10 days of maturation ...
-
bioRxiv - Immunology 2021Quote: ... and supplemented with recombinant mouse GM-CSF (20 ng/ml, Peprotech). Loosely adherent cells (DCs ...
-
bioRxiv - Genetics 2022Quote: ... supplemented with 50ng/mL recombinant mouse stem cell factor (rmSCF, Peprotech), 10ng/mL recombinant mouse interleukin 3 (rmIL-3 ...
-
bioRxiv - Bioengineering 2022Quote: ... Mouse neutrophils treated with recombinant human TGFβ1 (10 ng/mL; PeproTech) for 24 h served as a positive control for NR polarization 56.
-
bioRxiv - Cell Biology 2022Quote: ... and 30 ng/ml recombinant mouse GM-CSF (Peprotech #315-03) and seeded into a 15 cm dish ...
-
bioRxiv - Synthetic Biology 2022Quote: ... and mouse recombinant cytokines (100 ng/ml SCF (Peprotech, 250-03), 50 ng/ml Flt3-L (Peprotech ...
-
bioRxiv - Immunology 2023Quote: ... and mouse recombinant 10ng/ml IFN-γ (PEPROTech Cat.315-05). For mTORC1 activation cells were treated with 5nM Bafilomycin A1 (Invivogen Cat ...
-
bioRxiv - Microbiology 2023Quote: ... media containing recombinant mouse IL-4 (PeproTech, Cat. No. 214-14) was added to cells 16 hours before infection ...
-
bioRxiv - Cell Biology 2023Quote: ... in combination with 200 ng/mL recombinant mouse IL-18 (Peprotech) or 50 ng/mL of recombinant human IL-15 (Miltenyi ...
-
bioRxiv - Molecular Biology 2023Quote: ... 10 ng/ml mouse recombinant IL-4 (Peprotech, 214-14-20), and agonist anti-CD40 antibody (0.5 μg/ml ...
-
bioRxiv - Bioengineering 2021Quote: ... mouse femoral head explants were stimulated using 10□ng□ml-1 recombinant mouse IL-1β (PeproTech) for 2 days ...
-
bioRxiv - Immunology 2021Quote: ... co-cultures were treated with 100 ng/ml mouse recombinant IFNg (Peprotech). Activation of T-cells was assessed by flow cytometry on day 5.
-
Targeted attenuation of elevated histone marks at SNCA alleviates α-synuclein in Parkinson’s diseasebioRxiv - Neuroscience 2020Quote: ... and 100 ng/ml recombinant human/mouse FGF-8b (Peprotech, 100-25) from days 1-6 and 3-μM CHIR99021(Reprocell ...
-
bioRxiv - Immunology 2020Quote: ... and 20 ng/mL mouse recombinant GM-CSF (Peprotech, Rocky Hill, NJ). 10 mL media (50% of initial volume in Petri dish ...
-
bioRxiv - Immunology 2023Quote: ... and 10 ng/mL recombinant mouse IL-3 (Peprotech, Cat. # 213-13). TPA-MAT cells 40 were maintained in RPMI-1640 supplemented with 10% FBS ...
-
bioRxiv - Cell Biology 2024Quote: 0.15 ug/ml of recombinant mouse protein CXCL9 (Peprotech, Cat #: 250-18) and 0.1 ug/ml of recombinant mouse protein CXCL10 (Peprotech ...
-
bioRxiv - Microbiology 2020Quote: ... the PBMCs were cultured with the synthetic peptide mixture of SARS-CoV-2 at a concentration of 1μg/ml or DMSO in RPMI 1640 medium containing 10% FCS and 20 U/ml recombinant human IL-2 (Peprotech) for 7 days ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2024Quote: ... together with 10 ng/mL recombinant mouse IL-4 or 3 μg/mL LPS with 10 ng/mL recombinant murine IFN-ψ (Peprotech) and 20 ng/mL recombinant human BAFF or 5 μg/mL anti-CD40 (Bio X Cell ...
-
bioRxiv - Cell Biology 2021Quote: ... 20 ng/mL recombinant mouse macrophage colony-stimulating factor (PeproTech, Rocky Hill, NJ), and 5% penicillin/streptomycin ...
-
bioRxiv - Immunology 2022Quote: ... and supplemented with recombinant mouse M-CSF (Peprotech Inc. Cat No 315-02) at 20ng/mL for 5 days (Francke et al. ...
-
bioRxiv - Immunology 2023Quote: ... the organoid was stimulated with 150 ng/ml mouse recombinant TNF-α (PeproTech) for 24 h.45 All cells were cultured and maintained at 37 °C with 5% CO2.
-
bioRxiv - Cell Biology 2024Quote: ... and 0.1 ug/ml of recombinant mouse protein CXCL10 (Peprotech, Cat #: 250-16) pure ligands were plated in the bottom well of a 96 well transwell (Corning ...
-
bioRxiv - Immunology 2022Quote: ... or (15 ng/mouse) of recombinant-mouse IFN-γ (rIFN-γ expressed in E. coli; PeproTech, Rocky Hill, NJ), i.p ...
-
bioRxiv - Cancer Biology 2021Quote: The WNT/β-catenin pathway was stimulated with mouse recombinant WNT3a (Peprotech, NJ, USA) at a final concentration of 100 ng/ml ...
-
bioRxiv - Immunology 2022Quote: Recombinant mouse (m)CCL7 and human (h)CCL2 and hCCL7 were purchased from Peprotech. Recombinant hDPP4 was purchased from R&D ...
-
bioRxiv - Immunology 2019Quote: ... and supplemented with recombinant mouse GM-CSF and IL-4 (20 ng/ml, Peprotech). 293/NOD2 cells were obtained by stable transfection of HEK293 cells with the pUNO-hNOD2 plasmid which expresses the human NOD2 gene (Invivogen) ...
-
bioRxiv - Cell Biology 2019Quote: ... 10 ng/ml recombinant mouse granulocyte-macrophage colony-stimulating factor (PeproTech, Rocky Hill, NJ), and penicillin/streptomycin antibiotics (Wisent) ...
-
bioRxiv - Biochemistry 2022Quote: ... cells are treated with recombinant mouse IL-1β (211-11B, Peprotech, Cranbury, NJ USA) at 10 ng/mL ...
-
bioRxiv - Immunology 2021Quote: ... in presence of recombinant mouse IL-12 (100 ng/ml, Peprotech, Rocky Hill, NJ) and recombinant mouse IL-18 (100 ng/ml ...
-
bioRxiv - Neuroscience 2021Quote: ... and 25 ng/mL recombinant mouse stem cell factor (mSCF; Peprotech, Cranbury, NJ, USA), and plated onto glass coverslips coated with 30 mg/mL fibronectin (MilliporeSigma ...
-
bioRxiv - Immunology 2022Quote: ... and 5 ng/ml recombinant mouse macrophage colony stimulating factor (rm-M-CSF; PEPROTECH). The medium was exchanged on day 3 (retaining all cells ...
-
bioRxiv - Immunology 2023Quote: ... Standard curves were established using mouse recombinant IL-6 (Peprotech, 216-16; Cranbury, NJ) and IL-10 (Biolegend ...
-
bioRxiv - Immunology 2024Quote: Naïve mice were intraperitoneally treated with 250 ng of recombinant mouse IL-10 (Peprotech), and/or with 10 μg of both combined recombinant mouse IL-4-Fc and IL-13-Fc (5 μg of each ...
-
bioRxiv - Cell Biology 2024Quote: ... and 20 ng/ml recombinant mouse macrophage-colony stimulating factor (M-CSF; PeproTech, USA). After induction for 7 days ...
-
bioRxiv - Immunology 2023Quote: ... and cultured in the presence of 100 ng/mL recombinant mouse M-CSF (Peprotech) for 8 days ...
-
bioRxiv - Immunology 2019Quote: ... M2 polarization was performed by stimulating macrophages with 10ng/ml recombinant mouse IL-4 (Peprotech). For M1 polarization macrophages were stimulated with 100ng/ml LPS (LPS EK-Ultrapure ...
-
bioRxiv - Immunology 2019Quote: ... USA). Recombinant mouse M-CSF (cat. # 315-02) was from PeproTech (Rocky Hill, NK, USA). Sterile-filtered Histopaque 1119 (cat ...
-
bioRxiv - Immunology 2022Quote: ... LP cells were stimulated overnight in the presence of 15ng/ml recombinant mouse IL23 (Peprotech), followed by additional 4.5 hours with 500 ng/mL ionomycin and 20 ng/mL PMA in the presence of 1μg/mL of GolgiStop containing Monensin (BD Biosciences) ...
-
bioRxiv - Immunology 2023Quote: ... or stimulated for 24 hours with 5 ng/mL of recombinant mouse IL-12p70 (Peprotech) plus 5 ng/mL of recombinant mouse IL-18 (R&D Systems) ...
-
bioRxiv - Immunology 2022Quote: ... Cells were then washed and plated with 50 ng/ml of recombinant mouse IL-15 (Peprotech) and cultured for 4 days to assess proliferation ...
-
bioRxiv - Immunology 2022Quote: ... Complexes were prepared by mixing recombinant mouse IL-2 (Cat# 212-12, 100 μg/ml; Peprotech) with anti-IL-2 mAb at a molar ratio of 2:1 in PBS ...
-
bioRxiv - Immunology 2023Quote: ... the following agents were administered via intraperitoneal injection: recombinant mouse IL-15 (2.5 μg/dose; PeproTech), anti-mouse IL-15 antibody (25 μg/dose ...
-
bioRxiv - Immunology 2023Quote: Recombinant mouse TNF (Cat#315-01A) and IL-3 (Cat#213-13) were purchased from Peprotech. FBS (Cat# SH30396 ...