Labshake search
Citations for Peprotech :
7101 - 7150 of 7700 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2020Quote: ... human IL-2 (10 IU/mL, PeproTech), Paclitaxel (200 nM ...
-
bioRxiv - Immunology 2020Quote: ... IL-4 (10 ng/mL, PeproTech), human IL-2 (10 IU/mL ...
-
bioRxiv - Immunology 2020Quote: ... or LPS and recombinant IL-10 (PeproTech), or LPS and IFNAR1 blocking antibody (Invitrogen ...
-
bioRxiv - Immunology 2020Quote: ... Rinse solution was then aspirated and replaced with 1 mL of 2X concentrated EB medium (1X EB media: OXE8 medium supplemented with 50 ng/mL BMP4 (Peprotech, #PHC9534), 50 ng/mL VEGF (Peprotech ...
-
bioRxiv - Immunology 2020Quote: ... 50 ng/mL VEGF (Peprotech, #PHC9394), and 20 ng/mL SCF (Miltenyi Biotec ...
-
bioRxiv - Microbiology 2020Quote: ... 10 ng/ml BMP4 (Peprotech), 20 ng/ml FGF10 (Peprotech) ...
-
bioRxiv - Cell Biology 2020Quote: ... and Flt3L (10 ng ml−1) (all cytokines from Peprotech). Half-media changes were performed every 7 days ...
-
bioRxiv - Cell Biology 2020Quote: ... and 20 ng/ml IL-6 (Peprotech), 1 million PBMC were processed using the CytoTune-iPS 2.0 Sendai Reprogramming Kit (Invitrogen ...
-
bioRxiv - Developmental Biology 2020Quote: ... 100 ng/ml recombinant mouse Noggin (PeproTech), 50 ng/ml recombinant mouse EGF (Thermo Fisher Scientific) ...
-
bioRxiv - Developmental Biology 2020Quote: ... and 100 ng/ml murine Noggin (Peprotech, 250-38) and either 500 ng/ml mouse RSPO1 (R&D systems ...
-
bioRxiv - Developmental Biology 2020Quote: ... 50ng/ml human EGF (Peprotech, AF-100-15) and 100 ng/ml murine Noggin (Peprotech ...
-
bioRxiv - Developmental Biology 2020Quote: ... 50 ng/ml recombinant human FGF-basic (FGF-2) (Peprotech), 1 mg/ml recombinant human R-spondin1 (R&D) ...
-
bioRxiv - Developmental Biology 2020Quote: ... 25 ng/ml human recombinant FGF4 (PeproTech) and 1 μg/ml heparin (Sigma-Aldrich).
-
bioRxiv - Developmental Biology 2020Quote: ... 1% penicillin-streptomycin and with or without 2i-PD0325901 (1 μM) and CHIR99021 (3 μM) (PeproTech). All TSCs and iTSCs were grown in TSC medium containing a combination of 70% MEF conditioned medium and 30% freshly prepared medium ...
-
bioRxiv - Developmental Biology 2020Quote: ... 20 ng/ml HGF (Peprotech) and 3 μM CHIR-99021 for 5 days ...
-
bioRxiv - Developmental Biology 2020Quote: ... 5ng/ml bFGF (Peprotech), 4 μM IWP-2 (Tocris) ...
-
bioRxiv - Developmental Biology 2020Quote: ... RPMI-B27 (minus insulin) medium was supplemented with 20 ng/ml BMP4 (Peprotech), 5ng/ml bFGF (Peprotech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Bioengineering 2020Quote: ... supplemented with 100 ng/mL SCF (#250-03, Peprotech) and 0.1% PenStrep ...
-
bioRxiv - Neuroscience 2020Quote: ... 100ng/ml Noggin (Peprotech), and 10% R-spondin conditioned media (produced in house using Trevigen 3710-001-K cells ...
-
bioRxiv - Neuroscience 2020Quote: ... The human organoid media contained 500ng/ml human r-spondin (Peprotech) and was supplemented with 500nM A-83-01 (Tocris ...
-
bioRxiv - Neuroscience 2020Quote: ... 50ng/ml EGF (Peprotech), 100ng/ml Noggin (Peprotech) ...
-
bioRxiv - Genomics 2020Quote: ... 2ng/ml TGFβ (PeproTech), 10.7μg/ml human recombinant transferrin ...
-
bioRxiv - Genetics 2020Quote: ... the cells were treated with 60 ng/ml of IFNγ (PeproTech) for 3 hours ...
-
bioRxiv - Genetics 2020Quote: ... medium was replaced with 2ml CDM3 supplemented with Wnt-C59 (2μM, 1248913, Peprotech Biogems). After 96 hours (day 4) ...
-
bioRxiv - Genetics 2020Quote: ... cells were treated with 10 ng/ml purified recombinant human TNF-α (Peprotech, Rocky Hill, NJ) prepared in growth media containing 10 µg/ml of Actinomycin D (MP Biomedicals ...
-
bioRxiv - Genetics 2020Quote: ... cells were treated with 20 ng/ml purified FGFb (Peprotech, Rocky Hill, NJ) prepared in growth media ...
-
bioRxiv - Cancer Biology 2020Quote: ... were obtained from Sigma Aldrich and Trail (#310-04) from Peprotech. BiP inhibitor HA15 was described previously (Cerezo et al ...
-
bioRxiv - Cancer Biology 2020Quote: ... and 20 ng/ml bFGF (Peprotech, 100-18B). Human prostate cancer cell line PC3 was a gift from Dr ...
-
bioRxiv - Cancer Biology 2020Quote: ... 20 ng/ml EGF (Peprotech, 100-15), and 20 ng/ml bFGF (Peprotech ...
-
bioRxiv - Cancer Biology 2020Quote: ... 50ng/ml mEGF (Peprotech), 10% RSPO1 conditioned medium (home-made) ...
-
bioRxiv - Bioengineering 2020Quote: ... and IL-15 (5 ng/mL, PeproTech) at 37 °C and 5% CO2 ...
-
bioRxiv - Cell Biology 2020Quote: ... devoid of fatty acids and supplemented with the growth factors GDNF (20 ng/mL; Peprotech, NJ, USA) and FGF2 (1 ng/mL ...
-
bioRxiv - Cancer Biology 2020Quote: ... PDGF-AA and PDGF-BB were obtained from PeproTech and IGF-1 was obtained from R&D Systems ...
-
bioRxiv - Genomics 2020Quote: ... 3U/mL EPO (Peprotech), 100ng/mL SCF (Peprotech) ...
-
bioRxiv - Genomics 2020Quote: ... 100ng/mL SCF (Peprotech), 5µg/mL IL3 and 50µM hydrocortisone (Sigma ...
-
bioRxiv - Genomics 2020Quote: ... and Flt-3 (Peprotech) and cultured for 48 hours prior to electroporation.
-
bioRxiv - Genomics 2020Quote: ... 100ng/mL of TPO (Peprotech), SCF (Peprotech ...
-
bioRxiv - Genomics 2020Quote: ... 100ng/mL of TPO (Peprotech), SCF (Peprotech ...
-
bioRxiv - Cancer Biology 2020Quote: ... bFGF (20 ng ml-1 Peprotech), and EGF (20 ng ml-1 ...
-
bioRxiv - Cancer Biology 2020Quote: ... and EGF (20 ng ml-1, Peprotech). Cells were cultured as neurospheres and passaged every 5–7 days on the basis of sphere size ...
-
bioRxiv - Immunology 2020Quote: ... CD34 mice were injected subcutaneously with 250 ng human IL-7 (PeproTech) in PBS (Gibco) ...
-
bioRxiv - Microbiology 2020Quote: ... 500ng/ml FGF4 (Peprotech, 100-31-1MG), 2µM CHIR99021 and 10µM SB431542 (Tocris ...
-
bioRxiv - Microbiology 2020Quote: ... with the addition of 100ng recombinant murine IFN-γ (Peprotech, #315-05) for 18 hours ...
-
bioRxiv - Cancer Biology 2020Quote: ... and 50 ng/mL mSCF (Peprotech). Lentiviral shRNA plasmids were obtained from Sigma-Aldrich in the form of MISSION pLKO.1-puro vector ...
-
bioRxiv - Cancer Biology 2020Quote: ... and 15U recombinant human IL-2 (Peprotech, Inc. 200-02). CD45+ ...
-
bioRxiv - Cell Biology 2019Quote: ... 1 μg/ml prolactin (mouse recombinant for qPCR, western blot, immunohistochemistry and contraction control; Sigma or Peprotech) or sheep pituitary prolactin for time-lapse and confocal imaging ...
-
bioRxiv - Cell Biology 2019Quote: ... Factors gradients used were PDGF-BB (Peprotech) 0-20 ng/ml ...
-
bioRxiv - Cell Biology 2019Quote: ... Amphiregulin was ordered from Peprotech.
-
bioRxiv - Cell Biology 2019Quote: ... The media used were: FGF2 medium [2.5 nM FGF2 (Peprotech or Thermo Fisher Scientific) in BOM] ...