Labshake search
Citations for Peprotech :
601 - 650 of 1889 citations for Recombinant Human SCARB2 Fc His tagged since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2024Quote: ... 10 ng/ml recombinant human platelet-derived growth factor AA (PDGF; Peprotech 100-13A) and 1 ng/ml recombinant human neutrophin 3 (NT-3 ...
-
bioRxiv - Cancer Biology 2024Quote: ... Recombinant human interferon-gamma (IFN-γ, #300-02) was from PeproTech (Cranbury, NJ, USA) and stored at 100 µg/mL (10 % (v/v ...
-
bioRxiv - Immunology 2024Quote: ... for differentiation in mo-Mac or 10 ng/mL recombinant human GM-CSF (Peprotech) plus 20 ng/ mL recombinant human IL-4 (Peprotech ...
-
bioRxiv - Immunology 2024Quote: ... Th2 (10ng/mL recombinant human IL-2, 80ng/mL mIL-4 (Peprotech, 214-14), 10µg/mL anti-IFNγ ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Developmental Biology 2020Quote: ... and 5 ng/mL for each of brain-derived neurotrophic factor (BDNF, recombinant human, PeproTech, 450-02 ...
-
bioRxiv - Cell Biology 2022Quote: ... 100 μg/mL streptomycin and 20 ng/mL recombinant human EGF (AF-100-15, PeproTech).
-
bioRxiv - Genetics 2020Quote: ... and fresh pre-warmed media containing low dose recombinant human IL-7 (1ng/ml; Peprotech) was added to promote T cell survival without stimulation85 ...
-
bioRxiv - Cell Biology 2019Quote: ... 2 ng ml−1 recombinant human TGFβ1 (112 amino acid, HEK293-derived, Peprotech, 100-21). Cells were routinely maintained in E8 medium on 1:800 diluted growth factor reduced Matrigel (see below) ...
-
bioRxiv - Immunology 2019Quote: ... both in the presence or absence of 10 ng/mL recombinant human interferon gamma (Peprotech), all conditions in triplicate wells ...
-
bioRxiv - Immunology 2019Quote: ... cells were stimulated with recombinant human IL-2 (100 U/ml) (Peprotech, Rocky Hill, NJ) for 45 min at 37°C ...
-
bioRxiv - Neuroscience 2020Quote: ... and 20 ng/ml recombinant human Fibroblast Growth Factor-basic (FGF-2, 100-18B, Peprotech) onto poly-Lysine D coated cell culture plates (Corning) ...
-
bioRxiv - Bioengineering 2021Quote: ... 5 ng/mL human recombinant Platelet-Derived Growth Factor-AA (PDGF-AA, Peprotech, 100-13A) and 5 ng/mL FGF2 were added ...
-
bioRxiv - Bioengineering 2021Quote: ... 5 ng/mL human recombinant Platelet-Derived Growth Factor-AA (PDGF-AA, Peprotech, 100-13A) and 5 ng/mL FGF2 were added ...
-
bioRxiv - Bioengineering 2021Quote: ... 100 ng/mL animal-free recombinant human Stem Cell Factor (SCF, Peprotech, AF-300-07), and 10 µM RA ...
-
bioRxiv - Bioengineering 2021Quote: ... 100 ng/mL animal-free recombinant human Stem Cell Factor (SCF, Peprotech, AF-300-07), and 10 μM all-trans retinoic acid (RA ...
-
bioRxiv - Cell Biology 2021Quote: ... murine IL-3 (213-13) and Recombinant Human EPO (100-64) were obtained from PeproTech.
-
bioRxiv - Molecular Biology 2022Quote: ... Recombinant human tumor necrosis factor-alpha was purchased from PeproTech (Rocky Hill, NJ; #300-01A).
-
bioRxiv - Molecular Biology 2020Quote: ... 1 mL of base medium supplied with 12 μg/mL Recombinant Human FGF-basic (PEPROTECH) and KnockOutTM Serum Replacement (1:100 ...
-
bioRxiv - Microbiology 2020Quote: Dividing THP-1 cells were treated with 10 ng/mL recombinant human IL-1β (Peprotech) for the times indicated ...
-
bioRxiv - Bioengineering 2022Quote: A solution of 5 µg/mL FGF2 (recombinant human FGF-basic, Peprotech, New Jersey, USA) containing 0.1 % BSA (albumin fraction V (Carl Roth GmbH + Co ...
-
bioRxiv - Molecular Biology 2019Quote: ... but supplemented with 100 ng ml−1 human recombinant noggin (Peprotech, cat. no. 120-10C) and 20% R-spondin conditioned medium (Sigma ...
-
bioRxiv - Genomics 2021Quote: ... in a 3:1 beads:cells ratio and 100 U/mL recombinant human IIL-2 (Peprotech). Non-tissue culture treated 12-well plates were prepared by incubating 1 mL PBS + 25 μg/mL Retronectin (Takara ...
-
bioRxiv - Genomics 2021Quote: ... in a 3:1 beads:cells ratio and 100 U/mL recombinant human IL-2 (Peprotech).
-
bioRxiv - Immunology 2021Quote: ... we used complete media containing 20 ng/ml human recombinant interleukin-2 (rIL-2, PeproTech). Naïve CD4+ T cells (106/ml ...
-
bioRxiv - Immunology 2020Quote: ... M2c cells with 25 ng/mL recombinant human IL-10 (PeproTech; Rock Hill, NJ, USA); and M2d MΦs from stimulation with and 50 ng/mL recombinant human IL-6 (R&D Systems ...
-
bioRxiv - Immunology 2022Quote: ... cells were cultured in complete RPMI containing recombinant human IL-2 (30 U/ml, Peprotech) and stimulated with anti-CD3/anti-CD28 Dynabeads (Invitrogen ...
-
bioRxiv - Immunology 2022Quote: ... Monocytes were cultured in cRPMI supplemented with recombinant human IL-4 and GM-CSF (Peprotech) to generate immature monocyte-derived dendritic cells (Mo-DCs) ...
-
bioRxiv - Immunology 2022Quote: ... in the absence or presence of human recombinant (hr) IL-1β (10 ng/mL, Peprotech) and hrIL-23 (20 ng/mL ...
-
bioRxiv - Immunology 2022Quote: ... We further supplemented the media with 5 ng/mL recombinant human (rh) IL-2 (Peprotech) and 10 ng/mL rhIL-7 ...
-
bioRxiv - Molecular Biology 2022Quote: ... 200 ng/mL recombinant human fibroblast growth factor 10 (FGF10, PeproTech, Cat# 100-26-500), 1 nM gastrin (Tocris ...
-
bioRxiv - Cancer Biology 2024Quote: ... EGM-2 medium supplemented with VEGF (50 ng/ ml, Recombinant Human VEGF, Peprotech 100-20A) was then added in all the inlets and an interstitial flow was created by having different volumes of medium in the inlets (90ul in the inlets of the HUVEC channel and 110ul in the inlets of the opposite channel) ...
-
bioRxiv - Cell Biology 2024Quote: ... FibroGRO formulation was enriched with 75 ng/mL of Recombinant Human basic-FGF (bFGF, Peprotech). Medium was replaced every two days until day 20 of differentiation ...
-
bioRxiv - Immunology 2023Quote: ... USA)] in the presence of 10 ng/mL human recombinant M-CSF (PeproTech, Rocky Hill, NJ). Cells were incubated at a density of 3.0×106 cells/well for 7 days at 37 °C and 5% CO2 in ultra-low attachment six-well plates (Corning Life Sciences ...
-
bioRxiv - Bioengineering 2022Quote: ... were coated with 2 μg ml-1 of recombinant human PD-L1ECDFc (Peprotech 310-35), ZNRF3ECDFc (R&D systems 7994-RF-025 ...
-
bioRxiv - Molecular Biology 2023Quote: ... the cell culture medium was supplemented with 5 ng/ml recombinant human TGF-β (Peprotech), 10 µg/ml anti-IL-4 antibodies (clone 11B11) ...
-
bioRxiv - Cell Biology 2023Quote: ... and 2 ng/mL Recombinant Human Transforming Growth Factor-β1 (TGF-β1, PeproTech, 100-21). Cells were passaged when reaching 70% confluency until day 18 ...
-
A spatially resolved EGFR signaling model predicts the length scale of GAB1-SHP2 complex persistencebioRxiv - Systems Biology 2023Quote: ... Serum-starved cells were treated with recombinant human EGF (AF-100-15; PeproTech, Cranbury, NJ) at 10 ng/mL for ≤ 15 min ...
-
bioRxiv - Biochemistry 2023Quote: Cells were treated with 1000 U/mL of recombinant human IFN-β (PeproTech #300-02BC) or recombinant human IFN-α2 (PBL Assay Science #11105-1 ...
-
bioRxiv - Physiology 2023Quote: ... Recombinant Human TNF-α (300-01A) and IL-1β (200-01B) were acquired from PeproTech. DAPI (4’,6-diamidino-2-phenylindole ...
-
bioRxiv - Bioengineering 2024Quote: ... Human recombinant insulin-like growth factor-1 (rhIGF-1, 500 ng/mL, Peprotech, Cranbury, NJ) was added to the unmodified alginate and cRGD-alginate hydrogel as positive controls.
-
bioRxiv - Bioengineering 2020Quote: ... Primary human T cells were cultured in complete RPMI 1640 supplemented with 100 U/mL recombinant human IL-2 (PeproTech, 200-02). Cells were cultured at 37°C in a humidified 5% CO2 incubator.
-
bioRxiv - Bioengineering 2023Quote: ... Primary human T cells were cultured in complete RPMI 1640 supplemented with 100□U/ml recombinant human IL-2 (PeproTech, 200-02). All mammalian cells were cultured at 37□°C in a humidified 5% CO2 incubator.
-
bioRxiv - Immunology 2024Quote: ... The cells were incubated for 7 days in α-minimum essential medium (MEM) supplemented with 10% FCS and recombinant mouse macrophage colony stimulating factor (25 ng/ml, PeproTech) at 37°C and 5% CO2 ...
-
bioRxiv - Cell Biology 2020Quote: ... -coated dishes in StemFit medium (Ajinomoto) supplemented with 100 ng/mL recombinant human basic FGF (Peprotech), 100 U/mL Penicillin and 100 μg/mL Streptomycin (Thermo Fisher ...
-
bioRxiv - Cell Biology 2020Quote: ... cells were cultured in StemFit (Ajinomoto) supplemented with 100 ng/mL recombinant human basic FGF (Peprotech), 100 U/mL Penicillin and 100 μg/mL Streptomycin (Thermo Fisher).
-
bioRxiv - Developmental Biology 2021Quote: ... the medium was changed to N2B27 medium with 10 ng/ml recombinant human basic FGF (Peprotech) and 5 μM StemMACS CHIR99021 (Mitenyi Biotech) ...