Labshake search
Citations for Peprotech :
501 - 550 of 1273 citations for Lassa Fever Virus GP2 Protein Human Fc since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2023Quote: ... 10 ng/mL human EGF (Peprotech, AF-100-15), and 0.5 μg/mL puromycin (Invivogen).
-
bioRxiv - Cancer Biology 2023Quote: ... 500 µg/mL human EGF (Peprotech, AF-100-15) and 500 µM A83-01 (Tocris ...
-
bioRxiv - Immunology 2023Quote: ... and human recombinant IFNβ (Peprotech 300-02BC, 10ng/ml) or human recombinant TGFβ (Peprotech 100-21 ...
-
bioRxiv - Bioengineering 2023Quote: ... 100 ng/ml human M-CSF (Peprotech, NJ, USA) using 24 well plates (0.66 M cells/1.5ml ...
-
bioRxiv - Cell Biology 2023Quote: ... 20ng/mL human IL-3 (Peprotech ref.300-23) and 10ng/mL human G-CSF (Prepotech ref.200-02 ...
-
bioRxiv - Immunology 2023Quote: ... or human recombinant TGFβ (Peprotech 100-21, 2ng/ml). Initially ...
-
bioRxiv - Microbiology 2023Quote: ... 10 ng/ml human FGF10 (PeproTech, Cat# 100-26), 10 ng/ml human FGF7 (PeproTech ...
-
bioRxiv - Microbiology 2023Quote: ... 10 ng/ml human FGF7 (PeproTech, Cat# 100-19), 10 ng/ml human BMP4 (PeproTech ...
-
bioRxiv - Immunology 2023Quote: ... with human recombinant IL-2 (1 ng/ml, Peprotech), IL-7 (5 ng/ml ...
-
bioRxiv - Cancer Biology 2023Quote: ... 20 ng/mL Animal-Free Recombinant Human EGF (Peprotech), 40 ng/mL Recombinant Human FGF-basic (Peprotech) ...
-
bioRxiv - Neuroscience 2023Quote: ... Recombinant human PDGFAA (110-13A) was purchased from Peprotech, dissolved in Opti-MEM ...
-
bioRxiv - Immunology 2023Quote: ... and 5ng/ml of human recombinant interleukin-7 (Peprotech) and 5ng/ml human recombinant interleukin-15 (Miltenyi ...
-
bioRxiv - Immunology 2023Quote: ... and human recombinant TNFα (Peprotech 300-01A, 50ng/ml), human recombinant IFNα (Immunotools 11343516 ...
-
bioRxiv - Cell Biology 2023Quote: ... or 50 ng/ml of recombinant human IL17A (Peprotech) as indicated (all diluted in PneumaCult-ALI Medium) ...
-
bioRxiv - Microbiology 2023Quote: ... 10 ng/ml human BMP4 (PeproTech, Cat# 120-05ET), 20 ng/ml human EGF (PeproTech ...
-
bioRxiv - Developmental Biology 2024Quote: ... recombinant human R-spondin-1 80 ng/mL (Peprotech), recombinant human FGF-2 100 ng/mL (Peprotech) ...
-
bioRxiv - Immunology 2024Quote: ... and 10 ng/ml recombinant human IL-2 (PeproTech) for 5-day stimulation of memory B cells ...
-
bioRxiv - Immunology 2024Quote: ... Two days later human IL2 (Peprotech, East Windsor, NJ), was added at 10 ng/mL ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 10 ng/mL Recombinant Human PDGF-BB (Peprotech). NB039 and NB067 cells were treated with the following concentrations ...
-
bioRxiv - Systems Biology 2024Quote: ... Recombinant Human FGF (20 ng/mL) (PeproTech (100-18B), Recombinant Human EGF (10 ng/ml ...
-
bioRxiv - Immunology 2023Quote: ... and 20 ng/ml human recombinant IL-13 (PeproTech). Human macrophages were then cultured alone or with 0.1ug ...
-
bioRxiv - Genomics 2024Quote: ... supplemented with 50 µg/mL human M-CSF (PeproTech) for macrophage differentiation ...
-
bioRxiv - Bioengineering 2024Quote: ... 100 ng/mL recombinant human FGF10 (Peprotech; 100-26), 25 ng/mL recombinant human HGF (Peprotech ...
-
bioRxiv - Bioengineering 2024Quote: ... 25 ng/mL recombinant human HGF (Peprotech; 100-39), 10 μM forskolin (R&D Systems ...
-
bioRxiv - Bioengineering 2024Quote: ... 100 ng/mL recombinant human FGF19 (Peprotech; 100-32), 25 ng/mL recombinant human hepatocyte growth factor (HGF ...
-
bioRxiv - Immunology 2024Quote: ... 50 ng/ml human EGF (AF-100-15, Peprotech), 10 mM Nicotinamide (N0636 ...
-
bioRxiv - Biophysics 2021Quote: ... the medium was replaced by RPMI containing 10% FCS and 20 ng/mL of Macrophage Colony-Stimulating Factor (M-CSF) (Peprotech). For experiments ...
-
bioRxiv - Cell Biology 2021Quote: ... the remaining one-third of the chamber was filled with complete RPMI 1640 supplemented with 10% FCS in the presence or absence of 0.6 μg/ml murine CCL19 (Peprotech, USA). The slowly diffusing CCL19-containing medium creates a CCL19 gradient that promotes BMDC migration towards the upper part of the chamber.
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Immunology 2020Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Immunology 2022Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2020Quote: ... cells were seeded in complete DMEM medium (10% FCS, 1000 U/ml Penicillin, 100 µg/ml Streptomycin) containing 30 ng/mL of mouse M-CSF (Peprotech). After two successive medium replacement (at D3 and D6) ...
-
bioRxiv - Immunology 2021Quote: The differentiation of isolated monocytes into macrophages was performed in RPMI 1640 GlutaMAx medium with 10% FCS and 1% P/S containing 100 ng/mL macrophage colony-stimulating factor (M-CSF) (PeproTech) for 7 days ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2023Quote: ... mouse bone marrow was flushed and cultured for 2 days in stem cell medium (DMEM + 15% FCS + 25ng/ml SCF (PeproTech) + 10ng/ml IL-3 (PeproTech ...
-
bioRxiv - Cancer Biology 2021Quote: ... 20 ng/ml recombinant human GRO-α/MGSA (CXCL1; Peprotech), and 25 ng/ml recombinant human HGF (Peprotech) ...
-
bioRxiv - Cancer Biology 2021Quote: ... 20ng/ml Human FGF rec 154aa (Peprotech, GMP100-18 B), 10 ng/ml EGF (Sigma ...
-
bioRxiv - Cell Biology 2020Quote: ... 10 ng/mL recombinant human LIF (hLIF; Peprotech 300-05); 3 µM CHIR99021 (Tocris 4423) ...
-
bioRxiv - Cell Biology 2020Quote: Human recombinant TNF-α and RANK-L were from PeproTech. Mouse monoclonal antibody to glycoprotein-2 (Gp-2 ...
-
bioRxiv - Cell Biology 2020Quote: ... Human TGF-β was purchased from Peprotech (Rocky Hill, NJ). Cycloheximide ...
-
bioRxiv - Molecular Biology 2020Quote: ... human EGF 20 ng/mL (PeproTech, Rocky Hill, NJ, USA), tocopherol ...
-
bioRxiv - Developmental Biology 2020Quote: ... 20 ng/ml recombinant human ACTIVIN A (Peprotech 120-14E) and 8ng/ml bFGF (Peprotech).
-
bioRxiv - Neuroscience 2022Quote: ... 100 ng/ml Human IL34 (Peprotech; Cat. No. 200-34) and 10 ng/ml Human GM-CSF (Peprotech ...
-
bioRxiv - Molecular Biology 2020Quote: ... Recombinant human interleukin-2 (2 ng/ml, IL-2, Peprotech). Ficoll® lymphocyte separation medium (LSM ...
-
FOXO dictate initiation of B cell development and myeloid restriction in common lymphoid progenitorsbioRxiv - Immunology 2022Quote: ... 5ng/ml murine SCF and 5ng/ml human FL (PeproTech). Additional FL (5ng/ml ...
-
bioRxiv - Genomics 2020Quote: ... Recombinant human TGFβ (AF-100-21C) was purchased from PeproTech and was used at 25 ng/mL for 12 hours after 24 hours serum starvation of the cells.
-
bioRxiv - Developmental Biology 2019Quote: ... human recombinant R-spondin-1 500 ng/mL (PeproTech®), murine recombinant EGF 50 ng/mL (PeproTech® ...