Labshake search
Citations for Greiner :
151 - 200 of 408 citations for Rat Insulin Like Growth Factor Binding Protein 6 IGFBP6 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Developmental Biology 2023Quote: ... or to 6-well plates (Greiner Bio One), or to glass bottom micro-well dishes (MatTek ...
-
bioRxiv - Cell Biology 2023Quote: ... in 6 well culture dishes (Greiner Bio-One) coated with 0.5µg/mL Vitronectin (Thermo Fisher Scientific) ...
-
bioRxiv - Evolutionary Biology 2023Quote: ... using 6-well plates (Greiner Bio-One, Austria) as the culture vessel ...
-
Atypical epigenetic and small RNA control of transposons in clonally reproducing Spirodela polyrhizabioRxiv - Plant Biology 2024Quote: ... 6-wells culture plates (Greiner Bio-One #657185), or in 1L glass beakers (covered with a sterile plastic lid) ...
-
bioRxiv - Cell Biology 2024Quote: ... in 6-well plates (Greiner bio-one, #657160) and allowed to attach for 3-4 days ...
-
bioRxiv - Developmental Biology 2024Quote: ... A31804)-coated 6-well plates (Greiner Bio-One, 657160).
-
bioRxiv - Biophysics 2022Quote: Measurements of bacterial growth were performed using 96-well plates (Cellstar transparent flat-bottom, Greiner). Overnight cultures were inoculated at an initial OD600 of 0.01 in the same medium as used for growth in other experiments ...
-
bioRxiv - Immunology 2024Quote: Detection of cytokines in BALF was performed by sandwich ELISA using 96-well plates (Greiner) according to the manufacturer’s instructions (BD Biosciences) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... They were then transferred into the wells of a 96-well non-binding black microplate (Greiner Bio-One) and the fluorescence was read every 20 minutes at an excitation wavelength of 485nm and an emission wavelength of 520nm using a fluorescence microplate reader (EnVision 2104 Multilabel Reader (Perkin Elmer ...
-
bioRxiv - Neuroscience 2020Quote: ... Cells (12,000 cells/well) were plated in 96 well “V” bottom non-binding plates (Greiner Bio-One, #651970) and on day 2 ...
-
bioRxiv - Cancer Biology 2022Quote: All assays were performed at room temperature in low binding black 96-well microtiter plates (Greiner, 655 900) and measured as millipolarization (mP ...
-
bioRxiv - Biochemistry 2024Quote: ... 500 ng of each antibody was coated onto high-binding 96-well polystyrene microplates (#07000128; Greiner Bio-One) at 100 μl per well and incubated overnight at room temperature (RT) ...
-
bioRxiv - Pathology 2022Quote: ... 150,000 cells/cm2 were seeded with or without tetracycline (5 µg/ml) for 6 days on 6 well plate (Greiner, 657 160). Cells were lysed in Pierce NE-PER™ buffer (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2020Quote: 6 well culture plate (Greiner Bio-One, #657 160)
-
bioRxiv - Immunology 2022Quote: ... In a 6-well plate (Greiner Bio-One; 657160), entire viral medium was added to 4×106 HL-60 cells (seeded at a density of 0.25×106 cells/mL ...
-
bioRxiv - Immunology 2022Quote: ... cells were seeded into 6-well culture plates (Greiner) at a density of 3 × 105 cells per cm2 in 2 – 5 mL supplemented DMEM ...
-
bioRxiv - Bioengineering 2023Quote: ... The ciPTEC were seeded in 6 wells plates (Greiner) and transferred to 37 °C after 24h at 33 °C ...
-
bioRxiv - Cell Biology 2022Quote: ... the cells were passaged into roller bottles (CellMaster®, Greiner Bio-One, growth surface 2125 cm2). The old medium was removed ...
-
bioRxiv - Immunology 2022Quote: ... and 1:750 for Fcγ-receptor binding) overnight at 4°C in 384 well plates (Greiner Bio-One, Germany). Secondary antibodies were PE-conjugated and incubated with samples at room temperature for 1 hour at a 1:100 dilution in sterile-filtered Assay Buffer (1X PBS ...
-
bioRxiv - Neuroscience 2021Quote: 10uM of monomeric Biot-Aβ1-42 in 50mM Tris pH7.4 was pipetted to μclear medium binding half area plates (Greiner, #675096) and ThT was added to a final concentration of 25 μM ...
-
bioRxiv - Biochemistry 2022Quote: ... Ded1p assemblies were transferred to a medium binding Greiner µClear 384 well plate (Greiner Bio-One GmbH, Frickenhausen, Germany). The plates were briefly spun to allow sedimentation of the assemblies before imaging at room temperature.
-
bioRxiv - Immunology 2022Quote: ... and 1:750 for Fcγ-receptor binding) overnight at 4°C in 384 well plates (Greiner Bio-One, Germany). Unbound antibodies were removed by washing and subclasses ...
-
bioRxiv - Molecular Biology 2023Quote: ... each sample was transferred to a well of a 384-well non-binding microplate (µClear®, Greiner Bio-One) immediately after dilution with low salt buffer and imaged using a Nikon Ti2 inverted microscope with a 60× oil immersion objective ...
-
bioRxiv - Immunology 2024Quote: ... 40 μL of each sample was transferred to a flat-bottom ELISA plate (Greiner, Kremsmunster, Austria) and incubated at 4 °C overnight ...
-
bioRxiv - Cancer Biology 2020Quote: ... cells were seeded at a density of 5 x 104 cells/well of a 6-well plate (cell culture multiwell plate, 6 well, clear, sterile, (Greiner AG, Kremsmünster, Austria)) ...
-
bioRxiv - Microbiology 2020Quote: 6-well cell culture plate (Greiner Bio-One, catalog # 657160).
-
bioRxiv - Cell Biology 2022Quote: Appropriate cell lines were seeded in 6-well plates (Greiner) 48 hours prior to RNA isolation ...
-
bioRxiv - Microbiology 2022Quote: ... L cell monolayers in 6-well plates (Greiner Bio-One) were infected with 100 μL of diluted virus for 1 h at room temperature ...
-
bioRxiv - Microbiology 2019Quote: ... L cell monolayers in 6-well plates (Greiner Bio-One) were infected with 100 μl of diluted virus for 1 h at room temperature ...
-
bioRxiv - Microbiology 2019Quote: L cell monolayers in 6-well plates (Greiner Bio-One) were adsorbed with T1L ...
-
bioRxiv - Microbiology 2021Quote: ... L cells grown in 6-well plates (Greiner Bio-One) were infected with 250 μl of the diluted virus for 1 h at room temperature ...
-
bioRxiv - Microbiology 2021Quote: ... MEF cells grown in 6-well plates (Greiner Bio-One) were transduced with the lentivirus at 0.3 infectious units/cell diluted in 8 μg/ml polybrene (EMD Millipore ...
-
bioRxiv - Microbiology 2019Quote: L cell monolayers in 6-well plates (Greiner Bio-One) were adsorbed with T1L ...
-
bioRxiv - Microbiology 2019Quote: ... L cell monolayers in 6-well plates (Greiner Bio-One) were infected with 250 μl of diluted virus for 1 h at room temperature ...
-
bioRxiv - Microbiology 2020Quote: ... L cell monolayers in 6-well plates (Greiner Bio-One) were infected with 100 μl of diluted virus for 1 h at room temperature ...
-
bioRxiv - Microbiology 2022Quote: ... L cell monolayers in 6-well plates (Greiner Bio-One) were infected with 100 μl of diluted virus for 1 h at room temperature ...
-
bioRxiv - Genomics 2023Quote: ... ThinCert™ 6-well plate inserts (Greiner bio-one, 657640) were pre-coated with 50% Matrigel® (Corning ...
-
bioRxiv - Genetics 2023Quote: ... which were seeded into 6-well cell culture plates (Greiner) one day prior to transduction ...
-
bioRxiv - Microbiology 2023Quote: ... L cell monolayers in 6-well plates (Greiner Bio-One) were infected with 100 μl of diluted virus for 1 h at room temperature ...
-
bioRxiv - Cell Biology 2020Quote: ... supplied with 1ml in-house-generated granulocyte-macrophage colony stimulating factor (GM-CSF) into 94mm petri dishes (Greiner, 632180). At day 3 ...
-
bioRxiv - Synthetic Biology 2021Quote: ... 47 Assays were performed in 96-well microplate (half area, µCLEAR, black polystyrene, medium binding, non-sterile, Greiner Bio-One) with NADH fluorescence (λEx = 340 nm ...
-
bioRxiv - Biophysics 2020Quote: ... The samples were mixed by pipetting and 18 μl were transferred into 384 well medium-binding microplates (Greiner bio-one). The samples were incubated at RT for 20 min prior to imaging ...
-
bioRxiv - Neuroscience 2021Quote: The mixtures of Aβ1-42 and the peptides were pipetted to a μclear medium binding half area plates (Greiner, #675096) and ThT was added to a final concentration of 25 μM ...
-
bioRxiv - Immunology 2020Quote: ... mybiosource TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSM FGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK) or vehicle (PBS or chloroform) were plated on a high binding 96 well flat-bottomed plate (Greiner) and left at RT overnight ...
-
bioRxiv - Microbiology 2022Quote: ... Assays were performed in 20 μL volume in 384-well Non-binding Low-volume plates (Greiner Bio-One; Monroe, NC) at ambient temperature ...
-
bioRxiv - Developmental Biology 2022Quote: ... hiPSCs were plated at 10,000 cells per well in V-bottom 96-well low-cell-binding plates (Greiner Bio-One) in DB27 medium (DMEM/F12 HEPES ...
-
bioRxiv - Neuroscience 2022Quote: ... Thirty microliters of 1 μM human PrP23–111 (10 mM sodium carbonate, pH 9.6) was bound to high binding 384-well white plates (Greiner #G781074) with shaking at 400 RPM for 1 h at 37 °C ...
-
bioRxiv - Microbiology 2024Quote: ... at an excitation wavelength of 488 nm and an emission wavelength of 675 nm (50 nm bandwidth) and Black 1536-well flat bottom small volume microplates with a non-binding surface from Greiner Bio-One GmbH (Frickenhausen ...
-
bioRxiv - Microbiology 2024Quote: ... virus solutions were manually mixed immediately prior to deposition of 1 μL droplets on open 96-well plates (non-binding microplates, flat-bottom, transparent, Greiner Bio-One ...
-
bioRxiv - Immunology 2024Quote: ... BLI assays to detect tyrosine sulfation by binding antibodies with anti-sulfotyrosine antibodies were performed using polypropylene black 384-well microplate (Greiner) at 30°C in octet buffer (0.05% Tween in PBS) ...