Labshake search
Citations for Greiner :
2151 - 2200 of 2789 citations for Pregnanediol 3 Glucuronide PDG ELISA Kit 1 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2020Quote: ... plated in 0.1 mg/mL poly-L-ornithine / 5 µg/mL laminin-precoated 96-well imaging plates (Greiner, Kremsmünster, AU) and incubated overnight (37°C ...
-
bioRxiv - Neuroscience 2021Quote: The mixtures of Aβ1-42 and the peptides were pipetted to a μclear medium binding half area plates (Greiner, #675096) and ThT was added to a final concentration of 25 μM ...
-
bioRxiv - Neuroscience 2021Quote: Uncleared and cleared adipose tissue was immersed in 100ul of CUBIC2 reagent in a well of a 96 well plate microplate with clear bottom (Greiner). Tissue absorbance measurements were taken for every 2nm between 400nm-1000nm with the Spark M10 Microplate Reader (Tecan) ...
-
bioRxiv - Cell Biology 2021Quote: ... 180 μL of NF54/ap2g-re9h parasite culture was transferred from each well to a black 96-well plate (Greiner CELLSTAR microplate 655086 ...
-
bioRxiv - Microbiology 2020Quote: ... were seeded at 1.25e4 cells per well in 50 μL D10 in poly-L-lysine coated 96-well plates (Greiner 655930). After 24 h ...
-
bioRxiv - Neuroscience 2021Quote: ... 50 μl cell culture medium containing a total of 10×103 cells were plated in 384-well plates (Greiner, #781080). Plates were incubated for 24 hours at 37°C and 5% CO2 ...
-
bioRxiv - Neuroscience 2021Quote: Flp-In 293 cells stably expressing HaloTag-SNAP-NLS (see Supporting Information) were co-cultured with non-expressing cells on a 10-well-plate (Greiner bio-one ...
-
bioRxiv - Immunology 2020Quote: ... Larvae either remained in the Petri dishes for sampling for gene expression at later time points or were transferred individually to 24 wells plates (Greiner Bio-One BV ...
-
bioRxiv - Pathology 2022Quote: ... Samples were then centrifuged and 25μl added to a MicroAmp™ Fast Optical 96-Well Reaction Plate (Greiner bio-one), the reaction plate sealed with an optical adhesive cover (Applied Biosystems ...
-
bioRxiv - Physiology 2022Quote: ... The sample was then centrifuged and 25µl added to a MicroAmpTM Fast Optical 96-Well Reaction Plate (Greiner bio-one), the reaction plate sealed with an optical adhesive cover (Applied Biosystems ...
-
bioRxiv - Systems Biology 2022Quote: ... We then transferred 100 uL of the supernatant to a new flat bottom polystyrene plate (Greiner bio-one ref: 655101). We used the plate reader to take a spectrum of absorbance from 580 nm to 680 nm in increments of 10 nms ...
-
bioRxiv - Synthetic Biology 2022Quote: ... clear bottom 96-well plates (Cell Culture Microplates 96 Well μClear® CELLSTAR®, Greiner Bio-One GmbH, Product #: 655090), containing 200 μl of fresh M9 liquid media plus antibiotics and sealed with peelable foil (Sealing foil ...
-
bioRxiv - Microbiology 2020Quote: ... clear-bottom 96-well plates (Cell Culture Microplates 96 Well µClear® CELLSTAR®, Greiner Bio-One GmbH, Product #: 655090), which were sealed with peelable foil (Sealing foil ...
-
bioRxiv - Immunology 2019Quote: Isolated lymphocytes from spleens and lymph nodes were cultured in a sterile 96-well tissue culture plate (U-bottom; Greiner) at a density of 4×106 cells/mL in the presence of 10 µg/mL rPhl p 5 in T cell medium (RPMI-1640 ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... The venom and inhibitors were preincubated for 30 min at 37 °C and pipetted in triplicate onto 384-well plates (Greiner). A Labsystems Multidrop Reagent dispenser was used to dispense the substrate ...
-
bioRxiv - Biophysics 2019Quote: Fluorescence polarization-based peptide recruitment assays were performed in 20 μL reaction volumes in low volume 384 well plates offered by Greiner. Fluorescent peptides were labeled at the N-terminus with FITC (Lifetein) ...
-
bioRxiv - Cancer Biology 2019Quote: ... 5×103 human SCLC cells were seeded in a 96-well cell culture plate (Cat no.: 655180; Greiner Bio-One). After allowing cells to adhere during a 4h incubation at 37°C ...
-
bioRxiv - Cell Biology 2020Quote: ... the cells were immobilized on the glass surface of the microscopy plates (Greiner Sensoplate™, Greiner Bio-One GmbH, Austria) using Bio-conext (PSX1055 ...
-
bioRxiv - Synthetic Biology 2019Quote: ... The plate reader software converted measured optical density values into standard 10 mm cuvette readings based on the plate dimensions (96-well flat bottom, sterile, Greiner) and utilized liquid volume.
-
bioRxiv - Cell Biology 2019Quote: The cells were plated at 10,000 cells per well in a clear bottom black 96w plate (Greiner Cat. No. 655090) and a white 96w plate (Greiner Cat ...
-
bioRxiv - Molecular Biology 2021Quote: ... 154 mM NaCl) and test ingredients were added to the 384 well black plate (Greiner Bio-One Japan, Tokyo, Japan). Then ...
-
bioRxiv - Microbiology 2021Quote: ... in OptiMEM with 1 µg/ml of TPCK-treated trypsin in a 384-well black plate (final 50 µl/well) with transparent bottom (Greiner). Viral growth was measured at 8 ...
-
bioRxiv - Synthetic Biology 2019Quote: ... or 50 µM c-di-GMP [in screening buffer (-lysozyme, -PMSF)] in opaque white 96-well LUMITRAC 600 plates (Greiner) to generate final concentrations of 0 ...
-
bioRxiv - Developmental Biology 2019Quote: ... 200 cells in 40 μl ESGRO Complete Basal medium were grown in ultra-low attachment 96-well plates (Greiner BioOne) for 2 days until single EB had formed in every well ...
-
bioRxiv - Genetics 2020Quote: ... 50% expansion medium) and plated out in 20 μl droplet/well of a pre-warmed 48-wells tissue culture plate (Greiner). After polymerization ...
-
bioRxiv - Genetics 2020Quote: ... The cells were plated in 20 μL matrigel droplets/picked organoid (50% matrigel, 50% CCM+) in pre-warm 48-well tissue culture plates (Greiner) and maintained at 37°C and 5% CO2.
-
bioRxiv - Immunology 2021Quote: ... iPS cells were harvested with Accutase and single cell suspension were plated on round-bottom 96 well suspension plates (Greiner) with 4000 cells/well in serum free medium (SFM ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... The effluent was split in a 1:9 ratio of which the 10% fraction was sent to a Shimadzu SPD-M20A prominence diode array detector and the 90% fraction was directed to a nanofractionation collector which dispensed the fractions into transparent 384-well plates (F-bottom, rounded square well, polystyrene, without lid, clear, non-sterile; Greiner Bio One ...
-
bioRxiv - Microbiology 2021Quote: ... with 200 µL of pre-reduced BHIS and into a 96-deep well plate (Greiner Bio-One, Cat. #1986-2110) with 500 µL of pre-reduced BHIS using and incubated the cultures for 48 h ...
-
bioRxiv - Developmental Biology 2021Quote: ... stem cells were passaged with Accutase for 12 min and 1000-3000 cells in 50 μl of mTeSR1+B were seeded per well into polystyrene 96-well U-bottom plate (#650180; Greiner). Over the first 4 days ...
-
bioRxiv - Cell Biology 2020Quote: ... an acid-treated (HNO3) sterile 13 mm coverslip was placed into every well of a 24-well plate (662160, Greiner). This enabled an even distribution of Matrigel and made the cultures portable and accessible for downstream imaging assays ...
-
bioRxiv - Microbiology 2020Quote: ... Caspase 3/7 activity was measured at each time point by incubating cells in equal amounts of Caspase Glo solution and cell media for 30 min at RT and reading luminescence in a white 96-well plate (Greiner) with a Synergy HT or Synergy H1 plate reader (Biotek).
-
bioRxiv - Microbiology 2021Quote: Compounds from the libraries listed above were plated in a total of 29 assay-ready 384-well plates (Greiner #7810192). Dispensing of 6 μl of the compound solutions was achieved using an automated Agilent Bravo pipetting system ...
-
bioRxiv - Immunology 2020Quote: At day 0: The cells were plated in 100 μL of DMEM 10% FCS in a 96-well plate (Clear Bottom, Greiner): 12,000 cells per well for primary fibroblasts and fibroblast lines and 6,000 cells per well for the immortalized fibroblast lines.
-
bioRxiv - Immunology 2020Quote: ... antigens covalently coupled to MagPlex beads were added to a 96-well μClear® flat bottom plate (Greiner Bio-One) in multiplex resuspended in 50μL of PBS ...
-
bioRxiv - Immunology 2020Quote: ... mybiosource TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSM FGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK) or vehicle (PBS or chloroform) were plated on a high binding 96 well flat-bottomed plate (Greiner) and left at RT overnight ...
-
bioRxiv - Cell Biology 2021Quote: ... 1/24 of the HEK293 cells from a confluent T75 flask were used to seed 2 mL cultures in each well of polystyrene coated sterile 6 well plates (Greiner). Once cells were 30% - 50% confluent ...
-
bioRxiv - Microbiology 2020Quote: ... were inoculated from −80 °C freezer stocks into 200 µL of the medium of interest in shallow 96-well plates (Greiner) and grown overnight for 18 h while shaking at 37° C ...
-
bioRxiv - Microbiology 2022Quote: ... Assays were performed in 20 μL volume in 384-well Non-binding Low-volume plates (Greiner Bio-One; Monroe, NC) at ambient temperature ...
-
bioRxiv - Biochemistry 2022Quote: ... 1/24 of the HEK293 cells from a confluent T75 flask were used to seed 2 ml cultures in each well of polystyrene-coated sterile 6-well plates (Greiner). Once the cells were 30% to 50% confluent ...
-
bioRxiv - Bioengineering 2022Quote: ... duplicates of 100 µL of the supernatant were transferred to a black 96-well-plate (Greiner Bio-One International GmbH). The converted fluorescent products were photometrically quantified at an excitation wavelength of 544 nm and an emission wavelength of 590 nm using a plate reader (FLUOstar ...
-
bioRxiv - Cancer Biology 2022Quote: ... the pellet was resuspended in appropriate volume of BME for plating in 30 μL droplets on preheated suspension plates (Greiner).
-
bioRxiv - Bioengineering 2022Quote: Three cell lines of variable species-background were plated at a density of 3,000 cells (293T and CHO-K1) or 5,000 cells (NIH3T3) in their respective medium in black-walled 96-well-plates for optical imaging (Greiner, #655090). For transfection on the following day ...
-
bioRxiv - Cell Biology 2022Quote: ... A total of 1.5 pmol of siRNA (4 μl) was dispensed into each well of black clear-bottom 384-well plates (Greiner, 781091) with a Biomek FXP liquid handler (Beckman Coulter) ...
-
bioRxiv - Cell Biology 2022Quote: ... The ASM activity assay was then performed according to the manufacturer’s protocol on a 96-well black bottomed plate (Greiner, 655076) and the measurements were recorded using a fluorescence plate reader (Clariostar ...
-
bioRxiv - Developmental Biology 2022Quote: ... hiPSCs were plated at 10,000 cells per well in V-bottom 96-well low-cell-binding plates (Greiner Bio-One) in DB27 medium (DMEM/F12 HEPES ...
-
bioRxiv - Genomics 2022Quote: We find that the PSS protocol is streamlined by the use of glass-bottom well plates which support both imaging and enzymatic steps (e.g Greiner 655892). Importantly ...
-
bioRxiv - Developmental Biology 2022Quote: ... ETiX embryos in the AggreWell were transferred to CELLSTAR 6 well multiwell plate for suspension culture (Greiner Bio-One 657185) with 5ml of IVC1 (with FBS at 30% v/v ...
-
bioRxiv - Cancer Biology 2022Quote: To determine the maximum sublethal concentration of each drug—defined as its 48h EC20 concentration—cells were seeded onto 384-well tissue culture plates (Greiner 781080 Monroe ...
-
bioRxiv - Microbiology 2022Quote: ... A 200μL aliquot of inoculated organic acid solution for each strain was transferred to a 96-well U-Bottom plate (Greiner), in triplicate wells ...