Labshake search
Citations for Greiner :
2151 - 2200 of 2765 citations for Cyclic GMP Direct Chemiluminescent ELISA Kit 1 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2020Quote: ... an acid-treated (HNO3) sterile 13 mm coverslip was placed into every well of a 24-well plate (662160, Greiner). This enabled an even distribution of Matrigel and made the cultures portable and accessible for downstream imaging assays ...
-
bioRxiv - Microbiology 2020Quote: ... Caspase 3/7 activity was measured at each time point by incubating cells in equal amounts of Caspase Glo solution and cell media for 30 min at RT and reading luminescence in a white 96-well plate (Greiner) with a Synergy HT or Synergy H1 plate reader (Biotek).
-
bioRxiv - Microbiology 2021Quote: Compounds from the libraries listed above were plated in a total of 29 assay-ready 384-well plates (Greiner #7810192). Dispensing of 6 μl of the compound solutions was achieved using an automated Agilent Bravo pipetting system ...
-
bioRxiv - Immunology 2020Quote: At day 0: The cells were plated in 100 μL of DMEM 10% FCS in a 96-well plate (Clear Bottom, Greiner): 12,000 cells per well for primary fibroblasts and fibroblast lines and 6,000 cells per well for the immortalized fibroblast lines.
-
bioRxiv - Immunology 2020Quote: ... antigens covalently coupled to MagPlex beads were added to a 96-well μClear® flat bottom plate (Greiner Bio-One) in multiplex resuspended in 50μL of PBS ...
-
bioRxiv - Immunology 2020Quote: ... mybiosource TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSM FGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK) or vehicle (PBS or chloroform) were plated on a high binding 96 well flat-bottomed plate (Greiner) and left at RT overnight ...
-
bioRxiv - Cell Biology 2021Quote: ... 1/24 of the HEK293 cells from a confluent T75 flask were used to seed 2 mL cultures in each well of polystyrene coated sterile 6 well plates (Greiner). Once cells were 30% - 50% confluent ...
-
bioRxiv - Microbiology 2020Quote: ... were inoculated from −80 °C freezer stocks into 200 µL of the medium of interest in shallow 96-well plates (Greiner) and grown overnight for 18 h while shaking at 37° C ...
-
bioRxiv - Microbiology 2022Quote: ... Assays were performed in 20 μL volume in 384-well Non-binding Low-volume plates (Greiner Bio-One; Monroe, NC) at ambient temperature ...
-
bioRxiv - Biochemistry 2022Quote: ... 1/24 of the HEK293 cells from a confluent T75 flask were used to seed 2 ml cultures in each well of polystyrene-coated sterile 6-well plates (Greiner). Once the cells were 30% to 50% confluent ...
-
bioRxiv - Bioengineering 2022Quote: ... duplicates of 100 µL of the supernatant were transferred to a black 96-well-plate (Greiner Bio-One International GmbH). The converted fluorescent products were photometrically quantified at an excitation wavelength of 544 nm and an emission wavelength of 590 nm using a plate reader (FLUOstar ...
-
bioRxiv - Cancer Biology 2022Quote: ... the pellet was resuspended in appropriate volume of BME for plating in 30 μL droplets on preheated suspension plates (Greiner).
-
bioRxiv - Bioengineering 2022Quote: Three cell lines of variable species-background were plated at a density of 3,000 cells (293T and CHO-K1) or 5,000 cells (NIH3T3) in their respective medium in black-walled 96-well-plates for optical imaging (Greiner, #655090). For transfection on the following day ...
-
bioRxiv - Cell Biology 2022Quote: ... A total of 1.5 pmol of siRNA (4 μl) was dispensed into each well of black clear-bottom 384-well plates (Greiner, 781091) with a Biomek FXP liquid handler (Beckman Coulter) ...
-
bioRxiv - Cell Biology 2022Quote: ... The ASM activity assay was then performed according to the manufacturer’s protocol on a 96-well black bottomed plate (Greiner, 655076) and the measurements were recorded using a fluorescence plate reader (Clariostar ...
-
bioRxiv - Developmental Biology 2022Quote: ... hiPSCs were plated at 10,000 cells per well in V-bottom 96-well low-cell-binding plates (Greiner Bio-One) in DB27 medium (DMEM/F12 HEPES ...
-
bioRxiv - Genomics 2022Quote: We find that the PSS protocol is streamlined by the use of glass-bottom well plates which support both imaging and enzymatic steps (e.g Greiner 655892). Importantly ...
-
bioRxiv - Developmental Biology 2022Quote: ... ETiX embryos in the AggreWell were transferred to CELLSTAR 6 well multiwell plate for suspension culture (Greiner Bio-One 657185) with 5ml of IVC1 (with FBS at 30% v/v ...
-
bioRxiv - Cancer Biology 2022Quote: To determine the maximum sublethal concentration of each drug—defined as its 48h EC20 concentration—cells were seeded onto 384-well tissue culture plates (Greiner 781080 Monroe ...
-
bioRxiv - Microbiology 2022Quote: ... A 200μL aliquot of inoculated organic acid solution for each strain was transferred to a 96-well U-Bottom plate (Greiner), in triplicate wells ...
-
bioRxiv - Microbiology 2022Quote: 25 μl of ferret sera or human mAbs were two-fold serially diluted in 96-well V-bottom plates (Greiner) with PBS prior to being mixed with equal volume of H7N9 Anhui/13 (8 HA units) ...
-
bioRxiv - Microbiology 2022Quote: ... 50 μl of virus was two-fold serially diluted and added to the 96-well V- bottom shaped plates (Greiner), followed by addition of 50 μl of 1% chicken RBCs ...
-
bioRxiv - Synthetic Biology 2022Quote: ... clear bottom 96-well plates (Cell Culture Microplates 96 Well μClear® CELLSTAR®, Greiner Bio-One GmbH, Product #: 655090), which was sealed with peelable foil (Sealing foil ...
-
bioRxiv - Systems Biology 2022Quote: ... oneidensis knockout collection were replicated from a master collection (stored at -80 °Cwith a pin-tool (EnzyScreen CR1000) into a flat-bottom polypropylene plate (Part no. 655261, Greiner) containing 150 μL of LB media per well with 30 mg L-1 Kanamycin ...
-
bioRxiv - Synthetic Biology 2023Quote: Suspension and adherent cells were resuspended in fresh medium at 105 cells/ml and plated into a 48-well plate (Greiner). To limit evaporation ...
-
bioRxiv - Neuroscience 2022Quote: ... Thirty microliters of 1 μM human PrP23–111 (10 mM sodium carbonate, pH 9.6) was bound to high binding 384-well white plates (Greiner #G781074) with shaking at 400 RPM for 1 h at 37 °C ...
-
bioRxiv - Microbiology 2022Quote: ... Aliquots of 200 µL of each cell suspension were placed into 96-well flat bottom black plates (Greiner Bio-One). Fluorescence intensity (F ...
-
bioRxiv - Neuroscience 2022Quote: ... HEK293T cells were plated at a density of 5 million cells per 10 cm plate (Greiner Bio-One, 664-160) in 10 mL of complete DMEM media.16 hours after plating ...
-
bioRxiv - Synthetic Biology 2022Quote: ... CF-TXTL was conducted using 15 μL reaction solutions at 37 °C in a 96-well plate (polystyrene, solid bottom, half area, black-walled, Greiner Bio-One International GmbH ...
-
bioRxiv - Cancer Biology 2022Quote: Cell viability assays were performed by plating SUM159 WT or SUM159 ClpP null cells (1000 cells/well) on a 96-well plate (655-180, Greiner) in their respective media as indicated previously ...
-
bioRxiv - Bioengineering 2022Quote: A holder with 48 holes was custom-made (poly carbonate, designed in Inventor Professional, Autodesk) to fit a 48-wells plate (677180, Greiner) (Figure 2) ...
-
bioRxiv - Systems Biology 2024Quote: ... To determine the maximum sublethal concentration of each drug—defined as its 48h EC20 concentration—SF8628 and DIPG6 cells were seeded onto 384-well tissue culture plates (Greiner 781080 Monroe ...
-
bioRxiv - Pharmacology and Toxicology 2024Quote: ... the worms were transferred to the wells of a black wall/clear bottom 384-well plate (Greiner Bio-One 781986). Using a multichannel pipette ...
-
bioRxiv - Microbiology 2024Quote: ... Cells were counted using a haemocytometer and 105 cells were seeded into each well of a sterile 96-well flat-bottom polystyrene microtiter plate (Greiner) in a total volume of 100 μL ...
-
bioRxiv - Pathology 2024Quote: ... Samples were incubated for 5 h at room temperature and fluorescence polarization was measured in duplicate in a 384-well plate (Cat # 784900, Greiner) on a microplate reader (Spark ...
-
bioRxiv - Cancer Biology 2024Quote: ... About 0.5 to 1*106 were seeded in 2ml of full DMEM (2D culture) or a spheroid TSM-complete for 3D culture (Peterziel et al., 2022) into 6 well plates (Greiner, 657160 for adherent culture and Thermo Fisher ...
-
bioRxiv - Cell Biology 2023Quote: FCS measurements were carried out in 50 to 100 µl volume on a sylanized Sensoplate plus 384 well plate (Greiner) at room temperature ...
-
bioRxiv - Microbiology 2024Quote: Overnight cultures were diluted in LB to an optical density at 600 nm (OD600) of 0.01 and distributed into polystyrene 96-well flat- bottom plates (Greiner, 655185). Compound was added to the desired final concentration ...
-
bioRxiv - Microbiology 2024Quote: ... The cultures were then diluted to obtain a final OD600nm=0,01 using the medium of choice at a final volume of 150 μl per well in black 96-well plates with an optical flat bottom (Greiner) and ...
-
bioRxiv - Molecular Biology 2024Quote: ... INTS13-14 complex at concentrations ranging from 0.25 nM to 4 μM were briefly incubated with the GFP-tagged peptide in a black 384-well plate (Greiner) in a total reaction volume of 30 µL ...
-
bioRxiv - Microbiology 2024Quote: ... Overnight cultures were diluted 1:100 into 150 μl of fresh medium containing kanamycin in black 96-well plates with an optical flat bottom (Greiner). The cultures were incubated at 37°C in a shaking incubator at 150 RPM ...
-
bioRxiv - Immunology 2024Quote: ... A mixture of 600,000 HEK293T and 100,000 hCK cells per well were seeded in poly-D-lysine coated 6-well plates (Greiner, #657940). The next day when cells were ∼60-80% confluent ...
-
bioRxiv - Immunology 2023Quote: Primary macrophages were seeded with 1.5*105 live cells per well in a 48-well plate (Greiner BIO-ONE, Germany). After adherence ...
-
bioRxiv - Evolutionary Biology 2024Quote: ... we used the 96-pin replication tool to deposit cells from a 384 array quadrant in 96-well flat bottom plates (Greiner) filled with sterile water ...
-
bioRxiv - Physiology 2024Quote: C2C12 cells or Lonza SkMU cells cultured on a sterilized coverslip in 6-well plates (Greiner bio-one, CELLSTAR, 657160) were fixed in Fixx solution (Thermo Scientific ...
-
bioRxiv - Microbiology 2024Quote: ... albicans in LoFLo medium supplemented with 200 mg/L of riboflavin underwent three washing steps and were subsequently loaded into a U-shaped 96-well plate (Greiner) at an OD600 of 0.05 ...
-
bioRxiv - Bioengineering 2023Quote: ... transwell filters with adhered kidneys were placed against the bottom of a cover slip-bottom tissue culture plate (Greiner 662892).
-
bioRxiv - Biochemistry 2024Quote: ... Leaf punches were taken with a 4-mm biopsy punch and floated in 100 μL of H2O using individual cells of a white 96-well white bottom plate (Greiner F-Boden ...
-
bioRxiv - Biochemistry 2024Quote: ... leaf punches were taken with a 4-mm biopsy punch and floated in 100 μL of H2O using individual cells of a white 96-well white bottom plate (Greiner F-Boden ...
-
bioRxiv - Cell Biology 2024Quote: ... at 15µg/mL and 0,1 x106 cells in 200 µL were plated in 96 well plate (655892; Greiner Bio-One) 1 hour before imaging.