Labshake search
Citations for Greiner :
2101 - 2150 of 2747 citations for Thyroxine T4 ELISA Kit 5 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2021Quote: ... in OptiMEM with 1 µg/ml of TPCK-treated trypsin in a 384-well black plate (final 50 µl/well) with transparent bottom (Greiner). Viral growth was measured at 8 ...
-
bioRxiv - Synthetic Biology 2019Quote: ... or 50 µM c-di-GMP [in screening buffer (-lysozyme, -PMSF)] in opaque white 96-well LUMITRAC 600 plates (Greiner) to generate final concentrations of 0 ...
-
bioRxiv - Microbiology 2019Quote: NCI-60 cell lines were seeded by groups of cell origin at 3 × 104 cells per well in 96-well plates (Greiner, 655948 for Operetta ...
-
bioRxiv - Developmental Biology 2019Quote: ... 200 cells in 40 μl ESGRO Complete Basal medium were grown in ultra-low attachment 96-well plates (Greiner BioOne) for 2 days until single EB had formed in every well ...
-
bioRxiv - Biochemistry 2019Quote: ... 0.01% Brij 3) was dispensed into each well in a black solid bottom 1536-well assay plate (Greiner Bio-One) using a BioRAPTR FRD dispenser (Beckman Coulter ...
-
bioRxiv - Genetics 2020Quote: ... 50% expansion medium) and plated out in 20 μl droplet/well of a pre-warmed 48-wells tissue culture plate (Greiner). After polymerization ...
-
bioRxiv - Genetics 2020Quote: ... The cells were plated in 20 μL matrigel droplets/picked organoid (50% matrigel, 50% CCM+) in pre-warm 48-well tissue culture plates (Greiner) and maintained at 37°C and 5% CO2.
-
bioRxiv - Immunology 2021Quote: ... iPS cells were harvested with Accutase and single cell suspension were plated on round-bottom 96 well suspension plates (Greiner) with 4000 cells/well in serum free medium (SFM ...
-
bioRxiv - Immunology 2021Quote: The THP-1 cells were seeded in 96-well V-bottom cell culture plates (Greiner Bio-One GmbH, Frickenhausen, Germany) at a density of 4×104 cells in 100 μL growth medium per well and allowed to settle for 1 h ...
-
bioRxiv - Evolutionary Biology 2020Quote: Overnight cultures were diluted 1:103 in fresh competence medium and grown for 4.5 h (37°C, 250 rpm) in a 24-well microtiter plate (1 mL, final OD ≈ 0.25; Greiner Bio-one). Microtiter plates were covered with rayon film adhesive covers (VWR) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... The effluent was split in a 1:9 ratio of which the 10% fraction was sent to a Shimadzu SPD-M20A prominence diode array detector and the 90% fraction was directed to a nanofractionation collector which dispensed the fractions into transparent 384-well plates (F-bottom, rounded square well, polystyrene, without lid, clear, non-sterile; Greiner Bio One ...
-
bioRxiv - Microbiology 2021Quote: ... with 200 µL of pre-reduced BHIS and into a 96-deep well plate (Greiner Bio-One, Cat. #1986-2110) with 500 µL of pre-reduced BHIS using and incubated the cultures for 48 h ...
-
bioRxiv - Developmental Biology 2021Quote: ... stem cells were passaged with Accutase for 12 min and 1000-3000 cells in 50 μl of mTeSR1+B were seeded per well into polystyrene 96-well U-bottom plate (#650180; Greiner). Over the first 4 days ...
-
bioRxiv - Cell Biology 2020Quote: ... an acid-treated (HNO3) sterile 13 mm coverslip was placed into every well of a 24-well plate (662160, Greiner). This enabled an even distribution of Matrigel and made the cultures portable and accessible for downstream imaging assays ...
-
bioRxiv - Microbiology 2020Quote: ... Caspase 3/7 activity was measured at each time point by incubating cells in equal amounts of Caspase Glo solution and cell media for 30 min at RT and reading luminescence in a white 96-well plate (Greiner) with a Synergy HT or Synergy H1 plate reader (Biotek).
-
bioRxiv - Microbiology 2021Quote: Compounds from the libraries listed above were plated in a total of 29 assay-ready 384-well plates (Greiner #7810192). Dispensing of 6 μl of the compound solutions was achieved using an automated Agilent Bravo pipetting system ...
-
bioRxiv - Immunology 2020Quote: At day 0: The cells were plated in 100 μL of DMEM 10% FCS in a 96-well plate (Clear Bottom, Greiner): 12,000 cells per well for primary fibroblasts and fibroblast lines and 6,000 cells per well for the immortalized fibroblast lines.
-
bioRxiv - Immunology 2020Quote: ... antigens covalently coupled to MagPlex beads were added to a 96-well μClear® flat bottom plate (Greiner Bio-One) in multiplex resuspended in 50μL of PBS ...
-
bioRxiv - Immunology 2020Quote: ... mybiosource TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSM FGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK) or vehicle (PBS or chloroform) were plated on a high binding 96 well flat-bottomed plate (Greiner) and left at RT overnight ...
-
bioRxiv - Immunology 2021Quote: ... and 1:100 for all other readouts) for 2 hours at 37°C in 384-well plates (Greiner Bio-One). Unbound antibodies were washed away ...
-
bioRxiv - Cell Biology 2021Quote: ... 1/24 of the HEK293 cells from a confluent T75 flask were used to seed 2 mL cultures in each well of polystyrene coated sterile 6 well plates (Greiner). Once cells were 30% - 50% confluent ...
-
bioRxiv - Microbiology 2020Quote: ... were inoculated from −80 °C freezer stocks into 200 µL of the medium of interest in shallow 96-well plates (Greiner) and grown overnight for 18 h while shaking at 37° C ...
-
bioRxiv - Microbiology 2022Quote: ... Assays were performed in 20 μL volume in 384-well Non-binding Low-volume plates (Greiner Bio-One; Monroe, NC) at ambient temperature ...
-
bioRxiv - Biochemistry 2022Quote: ... 1/24 of the HEK293 cells from a confluent T75 flask were used to seed 2 ml cultures in each well of polystyrene-coated sterile 6-well plates (Greiner). Once the cells were 30% to 50% confluent ...
-
bioRxiv - Bioengineering 2022Quote: ... duplicates of 100 µL of the supernatant were transferred to a black 96-well-plate (Greiner Bio-One International GmbH). The converted fluorescent products were photometrically quantified at an excitation wavelength of 544 nm and an emission wavelength of 590 nm using a plate reader (FLUOstar ...
-
bioRxiv - Cancer Biology 2022Quote: ... the pellet was resuspended in appropriate volume of BME for plating in 30 μL droplets on preheated suspension plates (Greiner).
-
bioRxiv - Bioengineering 2022Quote: Three cell lines of variable species-background were plated at a density of 3,000 cells (293T and CHO-K1) or 5,000 cells (NIH3T3) in their respective medium in black-walled 96-well-plates for optical imaging (Greiner, #655090). For transfection on the following day ...
-
bioRxiv - Cell Biology 2022Quote: ... A total of 1.5 pmol of siRNA (4 μl) was dispensed into each well of black clear-bottom 384-well plates (Greiner, 781091) with a Biomek FXP liquid handler (Beckman Coulter) ...
-
bioRxiv - Cell Biology 2022Quote: ... 4×104 ECs per well were seeded for confluent experiments and 1×103 ECs per well for sparse experiments in fibronectin-coated 96-well plates (μClear, Greiner). Cells were cultured for 24h for sparse and 96h for confluent under basal conditions (EGMV2 ...
-
bioRxiv - Cell Biology 2022Quote: ... The ASM activity assay was then performed according to the manufacturer’s protocol on a 96-well black bottomed plate (Greiner, 655076) and the measurements were recorded using a fluorescence plate reader (Clariostar ...
-
bioRxiv - Developmental Biology 2022Quote: ... hiPSCs were plated at 10,000 cells per well in V-bottom 96-well low-cell-binding plates (Greiner Bio-One) in DB27 medium (DMEM/F12 HEPES ...
-
bioRxiv - Genomics 2022Quote: We find that the PSS protocol is streamlined by the use of glass-bottom well plates which support both imaging and enzymatic steps (e.g Greiner 655892). Importantly ...
-
bioRxiv - Developmental Biology 2022Quote: ... ETiX embryos in the AggreWell were transferred to CELLSTAR 6 well multiwell plate for suspension culture (Greiner Bio-One 657185) with 5ml of IVC1 (with FBS at 30% v/v ...
-
bioRxiv - Cancer Biology 2022Quote: To determine the maximum sublethal concentration of each drug—defined as its 48h EC20 concentration—cells were seeded onto 384-well tissue culture plates (Greiner 781080 Monroe ...
-
bioRxiv - Microbiology 2022Quote: ... A 200μL aliquot of inoculated organic acid solution for each strain was transferred to a 96-well U-Bottom plate (Greiner), in triplicate wells ...
-
bioRxiv - Microbiology 2022Quote: 25 μl of ferret sera or human mAbs were two-fold serially diluted in 96-well V-bottom plates (Greiner) with PBS prior to being mixed with equal volume of H7N9 Anhui/13 (8 HA units) ...
-
bioRxiv - Microbiology 2022Quote: ... 50 μl of virus was two-fold serially diluted and added to the 96-well V- bottom shaped plates (Greiner), followed by addition of 50 μl of 1% chicken RBCs ...
-
bioRxiv - Synthetic Biology 2022Quote: ... clear bottom 96-well plates (Cell Culture Microplates 96 Well μClear® CELLSTAR®, Greiner Bio-One GmbH, Product #: 655090), which was sealed with peelable foil (Sealing foil ...
-
bioRxiv - Systems Biology 2022Quote: ... oneidensis knockout collection were replicated from a master collection (stored at -80 °Cwith a pin-tool (EnzyScreen CR1000) into a flat-bottom polypropylene plate (Part no. 655261, Greiner) containing 150 μL of LB media per well with 30 mg L-1 Kanamycin ...
-
bioRxiv - Microbiology 2022Quote: ... The antigen-coupled microspheres were washed and incubated with heat-inactivated serum samples at an appropriate sample dilution (1:100-1:400 for antibody isotyping and 1:1,000 for all low-affinity FcγRs) overnight in 384-well plates with continuous shaking (Greiner Bio-One). Unbound antibodies were washed away using the magnetic 384-well HydroSpeed Plate Washer (Tecan ...
-
bioRxiv - Synthetic Biology 2023Quote: Suspension and adherent cells were resuspended in fresh medium at 105 cells/ml and plated into a 48-well plate (Greiner). To limit evaporation ...
-
bioRxiv - Neuroscience 2022Quote: ... Thirty microliters of 1 μM human PrP23–111 (10 mM sodium carbonate, pH 9.6) was bound to high binding 384-well white plates (Greiner #G781074) with shaking at 400 RPM for 1 h at 37 °C ...
-
bioRxiv - Microbiology 2022Quote: ... Aliquots of 200 µL of each cell suspension were placed into 96-well flat bottom black plates (Greiner Bio-One). Fluorescence intensity (F ...
-
bioRxiv - Synthetic Biology 2022Quote: ... CF-TXTL was conducted using 15 μL reaction solutions at 37 °C in a 96-well plate (polystyrene, solid bottom, half area, black-walled, Greiner Bio-One International GmbH ...
-
bioRxiv - Cancer Biology 2022Quote: Cell viability assays were performed by plating SUM159 WT or SUM159 ClpP null cells (1000 cells/well) on a 96-well plate (655-180, Greiner) in their respective media as indicated previously ...
-
bioRxiv - Bioengineering 2022Quote: A holder with 48 holes was custom-made (poly carbonate, designed in Inventor Professional, Autodesk) to fit a 48-wells plate (677180, Greiner) (Figure 2) ...
-
bioRxiv - Systems Biology 2024Quote: ... To determine the maximum sublethal concentration of each drug—defined as its 48h EC20 concentration—SF8628 and DIPG6 cells were seeded onto 384-well tissue culture plates (Greiner 781080 Monroe ...
-
bioRxiv - Pharmacology and Toxicology 2024Quote: ... the worms were transferred to the wells of a black wall/clear bottom 384-well plate (Greiner Bio-One 781986). Using a multichannel pipette ...
-
bioRxiv - Microbiology 2024Quote: ... Cells were counted using a haemocytometer and 105 cells were seeded into each well of a sterile 96-well flat-bottom polystyrene microtiter plate (Greiner) in a total volume of 100 μL ...
-
bioRxiv - Cancer Biology 2024Quote: ... About 0.5 to 1*106 were seeded in 2ml of full DMEM (2D culture) or a spheroid TSM-complete for 3D culture (Peterziel et al., 2022) into 6 well plates (Greiner, 657160 for adherent culture and Thermo Fisher ...