Labshake search
Citations for Greiner :
2001 - 2050 of 2567 citations for Catalase Colorimetric Activity Kit 2 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2020Quote: ... mybiosource TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSM FGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK) or vehicle (PBS or chloroform) were plated on a high binding 96 well flat-bottomed plate (Greiner) and left at RT overnight ...
-
bioRxiv - Microbiology 2020Quote: ... were inoculated from −80 °C freezer stocks into 200 µL of the medium of interest in shallow 96-well plates (Greiner) and grown overnight for 18 h while shaking at 37° C ...
-
bioRxiv - Microbiology 2022Quote: ... Assays were performed in 20 μL volume in 384-well Non-binding Low-volume plates (Greiner Bio-One; Monroe, NC) at ambient temperature ...
-
bioRxiv - Bioengineering 2022Quote: ... duplicates of 100 µL of the supernatant were transferred to a black 96-well-plate (Greiner Bio-One International GmbH). The converted fluorescent products were photometrically quantified at an excitation wavelength of 544 nm and an emission wavelength of 590 nm using a plate reader (FLUOstar ...
-
bioRxiv - Cancer Biology 2022Quote: ... the pellet was resuspended in appropriate volume of BME for plating in 30 μL droplets on preheated suspension plates (Greiner).
-
bioRxiv - Bioengineering 2022Quote: Three cell lines of variable species-background were plated at a density of 3,000 cells (293T and CHO-K1) or 5,000 cells (NIH3T3) in their respective medium in black-walled 96-well-plates for optical imaging (Greiner, #655090). For transfection on the following day ...
-
bioRxiv - Cell Biology 2022Quote: ... A total of 1.5 pmol of siRNA (4 μl) was dispensed into each well of black clear-bottom 384-well plates (Greiner, 781091) with a Biomek FXP liquid handler (Beckman Coulter) ...
-
bioRxiv - Cell Biology 2022Quote: ... 4×104 ECs per well were seeded for confluent experiments and 1×103 ECs per well for sparse experiments in fibronectin-coated 96-well plates (μClear, Greiner). Cells were cultured for 24h for sparse and 96h for confluent under basal conditions (EGMV2 ...
-
bioRxiv - Developmental Biology 2022Quote: ... hiPSCs were plated at 10,000 cells per well in V-bottom 96-well low-cell-binding plates (Greiner Bio-One) in DB27 medium (DMEM/F12 HEPES ...
-
bioRxiv - Genomics 2022Quote: We find that the PSS protocol is streamlined by the use of glass-bottom well plates which support both imaging and enzymatic steps (e.g Greiner 655892). Importantly ...
-
bioRxiv - Developmental Biology 2022Quote: ... ETiX embryos in the AggreWell were transferred to CELLSTAR 6 well multiwell plate for suspension culture (Greiner Bio-One 657185) with 5ml of IVC1 (with FBS at 30% v/v ...
-
bioRxiv - Cancer Biology 2022Quote: To determine the maximum sublethal concentration of each drug—defined as its 48h EC20 concentration—cells were seeded onto 384-well tissue culture plates (Greiner 781080 Monroe ...
-
bioRxiv - Microbiology 2022Quote: ... A 200μL aliquot of inoculated organic acid solution for each strain was transferred to a 96-well U-Bottom plate (Greiner), in triplicate wells ...
-
bioRxiv - Microbiology 2022Quote: 25 μl of ferret sera or human mAbs were two-fold serially diluted in 96-well V-bottom plates (Greiner) with PBS prior to being mixed with equal volume of H7N9 Anhui/13 (8 HA units) ...
-
bioRxiv - Microbiology 2022Quote: ... 50 μl of virus was two-fold serially diluted and added to the 96-well V- bottom shaped plates (Greiner), followed by addition of 50 μl of 1% chicken RBCs ...
-
bioRxiv - Synthetic Biology 2022Quote: ... clear bottom 96-well plates (Cell Culture Microplates 96 Well μClear® CELLSTAR®, Greiner Bio-One GmbH, Product #: 655090), which was sealed with peelable foil (Sealing foil ...
-
bioRxiv - Systems Biology 2022Quote: ... oneidensis knockout collection were replicated from a master collection (stored at -80 °Cwith a pin-tool (EnzyScreen CR1000) into a flat-bottom polypropylene plate (Part no. 655261, Greiner) containing 150 μL of LB media per well with 30 mg L-1 Kanamycin ...
-
bioRxiv - Microbiology 2022Quote: ... The antigen-coupled microspheres were washed and incubated with heat-inactivated serum samples at an appropriate sample dilution (1:100-1:400 for antibody isotyping and 1:1,000 for all low-affinity FcγRs) overnight in 384-well plates with continuous shaking (Greiner Bio-One). Unbound antibodies were washed away using the magnetic 384-well HydroSpeed Plate Washer (Tecan ...
-
bioRxiv - Synthetic Biology 2023Quote: Suspension and adherent cells were resuspended in fresh medium at 105 cells/ml and plated into a 48-well plate (Greiner). To limit evaporation ...
-
bioRxiv - Neuroscience 2022Quote: ... Thirty microliters of 1 μM human PrP23–111 (10 mM sodium carbonate, pH 9.6) was bound to high binding 384-well white plates (Greiner #G781074) with shaking at 400 RPM for 1 h at 37 °C ...
-
bioRxiv - Microbiology 2022Quote: ... Aliquots of 200 µL of each cell suspension were placed into 96-well flat bottom black plates (Greiner Bio-One). Fluorescence intensity (F ...
-
bioRxiv - Neuroscience 2022Quote: ... HEK293T cells were plated at a density of 5 million cells per 10 cm plate (Greiner Bio-One, 664-160) in 10 mL of complete DMEM media.16 hours after plating ...
-
bioRxiv - Synthetic Biology 2022Quote: ... CF-TXTL was conducted using 15 μL reaction solutions at 37 °C in a 96-well plate (polystyrene, solid bottom, half area, black-walled, Greiner Bio-One International GmbH ...
-
bioRxiv - Cancer Biology 2022Quote: Cell viability assays were performed by plating SUM159 WT or SUM159 ClpP null cells (1000 cells/well) on a 96-well plate (655-180, Greiner) in their respective media as indicated previously ...
-
bioRxiv - Bioengineering 2022Quote: A holder with 48 holes was custom-made (poly carbonate, designed in Inventor Professional, Autodesk) to fit a 48-wells plate (677180, Greiner) (Figure 2) ...
-
bioRxiv - Microbiology 2023Quote: ... 120 μL of the pre-cooled nitrocefin solutions were mixed inside pre-cooled clear 96-well plate (Greiner F-bottom) with 60 μL of pre-incubated PSMα solution (510 μM PSMα ...
-
bioRxiv - Neuroscience 2022Quote: ... diluted in lysis buffer (composition described before) were added to the 384-well assay plate (Low Volume-F Bottom catalog #784080; Greiner). Assay was performed according to (Fodale et al. ...
-
bioRxiv - Cell Biology 2023Quote: ... Assays were left for 20-60 min before being centrifuged and 10 μl of each concentration was loaded onto a black 384 well plate (Greiner) in triplicate ...
-
bioRxiv - Biochemistry 2022Quote: ... 150 μl of the resulting mixture was pipetted into 1 well of a 96-well plate (Greiner Bio-One, # 655076). CaM was used at a final concentration of 673 nM (13 ng/μl) ...
-
bioRxiv - Neuroscience 2022Quote: ... HEK293T cells were plated in Poly-L-lysine (100 μg/ml) coated 96-well black plates with μClear bottom (catalog #655090; Greiner) at 20.000 cells per well and transfected using Lipofectamine 2000 (Thermo Fisher Scientific ...
-
bioRxiv - Biochemistry 2022Quote: ... 75 μL of FRET peptide (100 μM in PBS) was added to a well of a 96-well Cellstar black plate (Greiner). Immediately prior to the assay ...
-
bioRxiv - Molecular Biology 2022Quote: ... For the screen 5,000 transiently transfected HEK293-TLR cells were seeded per well of a 384-well poly-d-lysine-coated cell culture plate (Greiner) containing the library compounds ...
-
bioRxiv - Biochemistry 2023Quote: ... 20 μmol/L unphosphorylated and phosphorylated C1mC2 fragments were incubated with 20-fold SYPRO Orange for 10 min at 25°C in black 96-well plates (Greiner), and SYPRO Orange fluorescence measured using appropriate excitation and emission filter settings using a ClarioStar plate reader (BMG Labtech).
-
bioRxiv - Molecular Biology 2023Quote: ... and 100 μl of the cell suspension was plated per well of white 96-well tissue culture plates (655083, Greiner). Dimethyl sulfoxide (DMSO ...
-
bioRxiv - Microbiology 2022Quote: ... Mixture reaction for pr titrations: 10 µL of purified virus (109-1010 ffu/mL) were incubated in a multi-well plate (Greiner) with increasing amounts of purified pr protein for 30 min at 37ºC in 100 mM Tris HCl pH 7.5 and 150 mM NaCl ...
-
bioRxiv - Microbiology 2023Quote: ... resulted in a density of 100-300 CFU on square plates (12 x 12 cm, Greiner bio-one, Kremsmünster, Austria). The media used for isolation are listed in Table S4 ...
-
bioRxiv - Molecular Biology 2023Quote: ... while the experiment was plated in a 384-well plate (Cell culture microplate 384 well black, Greiner Bio-one GmbH). Colonies were picked in a deep 96-well reservoir (with 1.5 ml of 2xYT medium plus relevant antibiotics) ...
-
bioRxiv - Immunology 2023Quote: ... murine SIRPα) were plated at ∼10,000 cells per well of a µClear 96-well plate (Greiner Bio One, cat. #655090) and cultivated overnight in standard conditions ...
-
bioRxiv - Microbiology 2023Quote: ... Log-phase cultures were inoculated at an initial OD600 of 0.01 in fresh commercial MRS in 96-microwell plates (Greiner, 655180) containing a dilution series of antibiotic at a final well volume of 200 µL ...
-
bioRxiv - Cell Biology 2023Quote: ... Fibroblasts were filtered through a 100 µm cell strainer (Falcon) and transferred to Matrigel-coated 15 cm2 cell culture plates (Greiner). Cells were grown to 90% confluence and subsequently passaged (1:3 ratio ...
-
bioRxiv - Cancer Biology 2023Quote: Cells were transfected with RIG-I or control agonist in white 96 well plates (Greiner Bio-One™ CellStar™). Viability ...
-
bioRxiv - Developmental Biology 2023Quote: ... 200 cells in 40 µl ESGRO Complete Basal medium were grown in ultra-low attachment 96-well plates (Greiner BioOne) for 2 days until EBs had formed ...
-
bioRxiv - Biochemistry 2023Quote: ... Inhibitor IC50 curves were generated with 7.5 μL final volume on 384 well low volume black plates (Greiner bio-one). Fluorescence was measured for 2 h at excitation and emission on a Synergy HTX Multi-Mode Microplate Reader (BioTek ...
-
bioRxiv - Biochemistry 2023Quote: ... at a concentration determined previously as the Tracer IC50 (Table S3) were pipetted into white 384-well plates (Greiner 781207) using an Echo acoustic dispenser (Labcyte) ...
-
bioRxiv - Cancer Biology 2022Quote: ... or pelleted sucrose fractions (3 µL) were loaded onto a 96-well white plate (Greiner Bio- One, Monroe, NC, USA). The Nluc and BRET signals were measured (integration time ...
-
bioRxiv - Plant Biology 2023Quote: ... fragments of six 10-day-old maize third leaves were excised and placed into individual wells of a black 96-well imaging plate (Greiner) filled with of 0.8% (w/v ...
-
bioRxiv - Genomics 2023Quote: Isolated primary Deer-RECs and commercially acquired HRECs (ATCC, Manassas, Virginia, USA; PCS-300-010, Lot-70002486) were subcultured on cell/tissue culture flasks or plates (Greiner Bio-One North America Inc ...
-
bioRxiv - Microbiology 2023Quote: ... 25 µL of each oligonucleotide/ThT mixture was then transferred in triplicate to wells of a black walled 96 well plate (Greiner) containing 25 µL of a serial titration of quarfloxin or CX-5461 ...
-
bioRxiv - Biochemistry 2023Quote: ... cells were trypsinized and seeded at a density of 25,000 cells / well in 96-well imaging plates (Greiner cat. 655090), then allowed to grow overnight in media containing 10 ng/mL doxycycline ...
-
bioRxiv - Developmental Biology 2023Quote: ... Ten thousand cells per organoid were plated in 20 µL hanging drops under the lid of a 127.8 x 85,5mm single-well plate (Greiner bio-one) in growth factor-free ...