Labshake search
Citations for Greiner :
151 - 200 of 329 citations for Rat Insulin Like Growth Factor Binding Protein 5 IGFBP5 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2021Quote: 10uM of monomeric Biot-Aβ1-42 in 50mM Tris pH7.4 was pipetted to μclear medium binding half area plates (Greiner, #675096) and ThT was added to a final concentration of 25 μM ...
-
bioRxiv - Biochemistry 2022Quote: ... Ded1p assemblies were transferred to a medium binding Greiner µClear 384 well plate (Greiner Bio-One GmbH, Frickenhausen, Germany). The plates were briefly spun to allow sedimentation of the assemblies before imaging at room temperature.
-
bioRxiv - Immunology 2022Quote: ... and 1:750 for Fcγ-receptor binding) overnight at 4°C in 384 well plates (Greiner Bio-One, Germany). Unbound antibodies were removed by washing and subclasses ...
-
bioRxiv - Molecular Biology 2023Quote: ... each sample was transferred to a well of a 384-well non-binding microplate (µClear®, Greiner Bio-One) immediately after dilution with low salt buffer and imaged using a Nikon Ti2 inverted microscope with a 60× oil immersion objective ...
-
bioRxiv - Immunology 2024Quote: ... 40 μL of each sample was transferred to a flat-bottom ELISA plate (Greiner, Kremsmunster, Austria) and incubated at 4 °C overnight ...
-
bioRxiv - Cell Biology 2020Quote: ... supplied with 1ml in-house-generated granulocyte-macrophage colony stimulating factor (GM-CSF) into 94mm petri dishes (Greiner, 632180). At day 3 ...
-
bioRxiv - Synthetic Biology 2021Quote: ... 47 Assays were performed in 96-well microplate (half area, µCLEAR, black polystyrene, medium binding, non-sterile, Greiner Bio-One) with NADH fluorescence (λEx = 340 nm ...
-
bioRxiv - Biophysics 2020Quote: ... The samples were mixed by pipetting and 18 μl were transferred into 384 well medium-binding microplates (Greiner bio-one). The samples were incubated at RT for 20 min prior to imaging ...
-
bioRxiv - Neuroscience 2021Quote: The mixtures of Aβ1-42 and the peptides were pipetted to a μclear medium binding half area plates (Greiner, #675096) and ThT was added to a final concentration of 25 μM ...
-
bioRxiv - Immunology 2020Quote: ... mybiosource TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSM FGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK) or vehicle (PBS or chloroform) were plated on a high binding 96 well flat-bottomed plate (Greiner) and left at RT overnight ...
-
bioRxiv - Microbiology 2022Quote: ... Assays were performed in 20 μL volume in 384-well Non-binding Low-volume plates (Greiner Bio-One; Monroe, NC) at ambient temperature ...
-
bioRxiv - Developmental Biology 2022Quote: ... hiPSCs were plated at 10,000 cells per well in V-bottom 96-well low-cell-binding plates (Greiner Bio-One) in DB27 medium (DMEM/F12 HEPES ...
-
bioRxiv - Neuroscience 2022Quote: ... Thirty microliters of 1 μM human PrP23–111 (10 mM sodium carbonate, pH 9.6) was bound to high binding 384-well white plates (Greiner #G781074) with shaking at 400 RPM for 1 h at 37 °C ...
-
bioRxiv - Microbiology 2024Quote: ... at an excitation wavelength of 488 nm and an emission wavelength of 675 nm (50 nm bandwidth) and Black 1536-well flat bottom small volume microplates with a non-binding surface from Greiner Bio-One GmbH (Frickenhausen ...
-
bioRxiv - Microbiology 2024Quote: ... virus solutions were manually mixed immediately prior to deposition of 1 μL droplets on open 96-well plates (non-binding microplates, flat-bottom, transparent, Greiner Bio-One ...
-
bioRxiv - Immunology 2024Quote: ... BLI assays to detect tyrosine sulfation by binding antibodies with anti-sulfotyrosine antibodies were performed using polypropylene black 384-well microplate (Greiner) at 30°C in octet buffer (0.05% Tween in PBS) ...
-
bioRxiv - Microbiology 2022Quote: ... Growth took place in 96-well cell culture plates (F-bottom; Greiner Bio-One, Fischer Scientific, US) with 200 μL working volume in thermostated plate-shakers at 30 °C and 600 rpm (PST-60HL ...
-
bioRxiv - Molecular Biology 2020Quote: ... Two μL of antibody diluted in PBS (pH 7.4) was coated on a high-binding 96-well polystyrene microplate (Greiner Bio-One) with 100 μL per well and incubated overnight at room temperature (RT) ...
-
bioRxiv - Cancer Biology 2021Quote: The assays were performed at room temperature using assay buffer (PBS, pH 7.4, 0.01% v/v Tween 20) and black 384-well non-binding polystyrene microplate (Greiner Bio-one, #784900). The peptide of interest was first diluted (10-point ...
-
bioRxiv - Molecular Biology 2022Quote: ... The assay samples (total volume 100 μL) were mixed in a black non-binding 96-well plate (Greiner Bio-One, Switzerland). The plate was sealed (Nunc™ ...
-
bioRxiv - Biochemistry 2021Quote: Measurements were taken in a 96-well black plate (Microplate 96 Well PS F-Bottom Black Non-Binding, Greiner Bio-one) using a TECAN M1000 Pro ...
-
bioRxiv - Bioengineering 2023Quote: ... All binding assays were performed with six replicates and carried out in 0.2 mL 96-well round bottom microplates (Greiner Bio-One) with crystalline cellulose (Avicel PH-101 ...
-
bioRxiv - Microbiology 2020Quote: ... histolytica trophozoites maintained in the logarithmic phase of growth were seeded into 96-well plates (Greiner Bio-One) at 5,000 cells/well to a total volume of 100 μl/well ...
-
bioRxiv - Molecular Biology 2022Quote: ... 100µl of inactivated FMDV (10µg/ml) in PBS were coated in 96-well ELISA Maxisorp plates (Greiner, Germany), followed by overnight incubation at 37°C ...
-
bioRxiv - Biochemistry 2022Quote: ... Initial assay development was performed in 384-well Lumitrac plates (White, flat bottom, medium binding, Cat# 781075, Greiner Bio-One, Monroe, NC). HTS assays were done in Aurora 1536 plates (white ...
-
bioRxiv - Microbiology 2022Quote: ... and 100 μl was added to the wells of a 96-well MICROLON 200 medium binding plate (Greiner Bio-One, Kremsmünster, Austria). For LPS samples ...
-
bioRxiv - Cell Biology 2019Quote: ... 50 mM Tris·HCl pH 7.4 and 1 mM DTT in a 20 µl volume in non-binding clear bottom 384 well plates (Greiner Bio-One, 781906). Compounds ...
-
bioRxiv - Molecular Biology 2021Quote: ... re-suspended in 25 μl HBSS and then transferred to a previously blocked well of an opaque 96 well high-binding plate (Greiner Bio-One). Chemiluminescence was detected in HBSS using 83.3 μM luminol and 1.5 x 105 PMNs at 37°C for 1 h to characterize the PMN response ...
-
bioRxiv - Biophysics 2023Quote: ... Then the solutions were mixed and loaded 100 µL in a 96 well plate (microplate, PS, half area, µClear, Med. binding, Black, Greiner Bio-one). The spectra were recorded from 425 nm to 650nm (10 nm bandwidth ...
-
bioRxiv - Microbiology 2024Quote: ... in-house purified KL64 capsule and O2a and O1 O-antigens were used to coat high-binding 384-well plates (Greiner ref. 781061) and incubated at 4°C ON ...
-
bioRxiv - Immunology 2024Quote: ... A portion of 4 μl per well of this mixture was distributed in white low-volume medium-binding HTRF-adapted 384-well assay plates (784075, Greiner Bio-One). This was followed by the addition of the samples (tissue culture supernatants ...
-
bioRxiv - Microbiology 2019Quote: ... Nearly all fitness assays were performed in 1.2 mL of growth medium in either a 24-well transparent microplate (Greiner) or in a 96-deepwell plate (Costar) ...
-
bioRxiv - Cell Biology 2023Quote: IMR32 cells were plated in 40 μL of growth medium (5000 cells/well) in white 384-well plates (Greiner). The next day each well was transfected with 100 ng pTI-ARE-LUC using FuGENE HD (4 μL per ug DNA ...
-
bioRxiv - Synthetic Biology 2021Quote: ... release assay previously described in the literature.43-45 Assays were performed in 96-well microplate (black, polystyrene, µ-clear, f-bottom, chimney well, med binding; Greiner Bio-One) by monitoring free CoA with DTNB at 412 nm using a Synergy Mx microplate reader (Biotek) ...
-
bioRxiv - Synthetic Biology 2021Quote: ... 2 μL of CFPS reaction were diluted with 198 μL of 10mM Tris-HCl pH 7.5 in a black 96-well plate (655076 PS medium binding; Greiner Bio-One Vilvoorde, Belgium). After a double orbital shake for 10 seconds at 300 rpm ...
-
bioRxiv - Cell Biology 2022Quote: ... In vitro binding was performed in a 96-well micro assay plate with black walls and clear bottom (Greiner Bio-One, Kremsmünster, Austria) in triplicates ...
-
bioRxiv - Microbiology 2023Quote: ... 1- or 2-μl droplets were deposited in the wells of a 96-well plate with a non-binding surface (Greiner Bio-One, 655901), one droplet per well ...
-
bioRxiv - Immunology 2019Quote: ... The cells were resuspended in growth medium and transferred to a 96-well U bottom plate (Greiner BioOne, Cellstar, #650180) and harvested by centrifugation ...
-
bioRxiv - Microbiology 2020Quote: Isolates growth curves were determined from Brain Heart Infusion broth (BHI) cultures incubated in 96-well flat bottom plates (Greiner) for 24 h at 37 °C with continuous optical density monitoring at 600 nm (Tecan Infinite® 200 PRO) ...
-
bioRxiv - Microbiology 2022Quote: In vitro growth curves were obtained by growing 200 µL of Xcc suspensions in 96-well flat-bottom microtiter plates (Greiner) within a FLUOStar Omega apparatus (BMG Labtech ...
-
bioRxiv - Immunology 2021Quote: Synthetic peptides (0.75 nmole in 50 μl PBS/per well) were added into 96-well ELISA microplates (Greiner bio-one). After an overnight incubation at 4 °C ...
-
bioRxiv - Immunology 2020Quote: Total and NP-specific antibody levels were measured by ELISA on half-area 96-well plates (Greiner Bio-One, 675061). Wells were coated overnight at +4°C with capture antibodies (2 μg/mL ...
-
bioRxiv - Systems Biology 2021Quote: ... which was later divided into three technical replicates of 10 μl during transferring to 384 well micro-plates (low binding microplate, 384 well, E18063G5, Greiner Bio-One, Kremsmünster, Austria). In total ...
-
bioRxiv - Biochemistry 2021Quote: ... which was later divided into three technical replicates of 10 μl upon transferring to 384-well micro-plates (low binding microplate, 384 well, E18063G5, Greiner Bio-One, Kremsmünster, Austria). In total ...
-
bioRxiv - Biophysics 2022Quote: ... solubilized wildtype rat receptors and C1/C2 heterodimers were further diluted 2- and 4-times in acquisition buffer together with increasing concentrations of Glutamate or Glutamate + 10 µM BINA on white 384 well plates (polystyrene, flat-bottom, small volume, medium-binding, Greiner Bio-One SAS, France). Dose-response curves at different time points after storage of the samples at RT were obtained by LRET acquisitions on a Spark 20M (Tecan ...
-
bioRxiv - Plant Biology 2023Quote: ... individual fronds of Lemna minor were placed in 100 μl of growth media per well in black 96 multi-well plates (Greiner Bio-one) displaying a low auto-fluorescence thereby minimizing interference with the Chl fluorescence signal detection.
-
bioRxiv - Immunology 2023Quote: ... After 7 days of cell culture were plated in a density of 17-20 × 106 cells/mL in BMDM medium supplemented with 5ng/mL of recombinant mouse macrophage colony stimulating factor (mCSF, R&D Biosystems, Minneapolis, USA, 416-ML-500) onto non-treated 100mm tissue culture Petri dishes (Greiner Bio-One, St. Gallen, Switzerland) for 7 days at 37°C and 5% CO2 the cells were harvested by incubation with 0.05% Trypsin.
-
bioRxiv - Cell Biology 2022Quote: 2’500 siRNA transfected cells were seeded 24h after transfection per well in 100 µl of standard growth media in cell-repellent 96 well microplates (Greiner Bio-one, 650790). Plates were incubated 24 hours at 37°C in 5% CO2 to allow spheroid formation ...
-
bioRxiv - Microbiology 2021Quote: ... grown overnight in 50 µL of D10 growth media in a 96-well black-walled poly-L-lysine coated plate (Greiner Bio-One, 655936). Relative luciferase units (RLU ...
-
bioRxiv - Microbiology 2021Quote: ... grown overnight in 50 μL of D10 growth media in a 96-well black-walled poly-L-lysine coated plate (Greiner Bio-One, 655936). Relative luciferase units (RLU ...