Labshake search
Citations for Greiner :
101 - 150 of 216 citations for GA binding protein alpha chain GABPA Antibody since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... Aggregation of Aβ was measured using 96 well non-binding black microplate (Greiner Bio-One). Approximately 10 μl of 2mM ThT ...
-
bioRxiv - Developmental Biology 2022Quote: ... aggregates were transferred to U-bottom 96-well low-cell-binding plates (Greiner Bio-One) in a mesoderm-inducing medium containing 0.3 ng/ml BMP4 (R&D Systems ...
-
bioRxiv - Genomics 2022Quote: Spheres were sorted into 96 well plates (non-binding, v-shaped, Greiner bio-one #651901) filled with 30 μl dissociation medium ...
-
bioRxiv - Immunology 2022Quote: ... the antigen was diluted with coating buffer for coating on high binding ELISA plate (Greiner Bio-One MICROLON high binding ELISA plate) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... Worms were transferred into the wells of 96 well non-binding black microplate (Greiner Bio-One) and read every 20 minutes at an excitation wavelength of 485 nm and an emission wavelength of 520 nm using a flourescence microplate reader (EnVision 2104 Multilabel Reader (Perkin Elmer ...
-
bioRxiv - Systems Biology 2021Quote: ... and non-binding flat-bottom 96-wells plates (model 655901, Greiner Bio-One GbmH, Kremsmünster, Austria) were used for recording spectrophotometric changes in the reaction mixtures ...
-
bioRxiv - Synthetic Biology 2023Quote: ... and added to six wells of a medium-binding microplate (655076, Greiner Bio-One, Kremsmünster, Germany) and incubated for 20 hrs at room temperature in the dark ...
-
bioRxiv - Cell Biology 2023Quote: ... 0.5 mM TCEP) and reactions spotted on 96-well non-binding µclear plates (Greiner Bio-One) for microscopy ...
-
bioRxiv - Immunology 2024Quote: ... LUMITRAC 600 high-binding white polystyrene 384-well microplates (Greiner Bio-One, #781074; VWR, #82051-268) were first pre-coated overnight with 10uL per well of antigen (Ag) ...
-
bioRxiv - Biochemistry 2020Quote: ... and 1 mM NaOH were given into the wells of a 96-well low-binding plate (Greiner) such that if filled up to 100 μL ...
-
bioRxiv - Biophysics 2021Quote: ... in white 384 well plates (polystyrene, flat-bottom, small volume, medium-binding, Greiner Bio-One SAS, France). Measurements where performed in acquisition buffer in the presence of indicated ligands at room temperature and plates where sealed and stored in the dark in between measurements for time course experiments to minimize evaporation and fluorophore bleaching ...
-
bioRxiv - Synthetic Biology 2021Quote: ... Luminescence reactions were mixed in a white 96-well plate (Greiner Bio-One 655075 PS medium binding) by combined 40 μL of diluted protein (CFPS reaction or standard protein ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... Streptavidin (3 μg/mL; Fisher) was precoated onto the surface of 96 well plates (high binding; Greiner) in Na2CO3 buffer (50 mM ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... into columns of a 1536-well white solid-bottom medium binding plate (Greiner Bio-One, Monroe, NC). Substances (final concentrations of most substances ranged from 19.5 nM – 39.8 μM ...
-
bioRxiv - Immunology 2023Quote: ... 0.1ug of RBD per well was immobilized on a High binding Microplatte (Greiner Bio-One GmbH, Austria.) and incubated ON at 4°C ...
-
bioRxiv - Cancer Biology 2023Quote: ... and loaded the solution (25 µL per well) into a high-binding 384-well plate (Greiner, 781077). The plate was placed on an orbital shaker ...
-
bioRxiv - Biochemistry 2023Quote: ... gently vortexed and pipetted into non-binding surface black 96-well plates (Greiner Bio-One, Frickenhausen, Austria) in triplicates ...
-
bioRxiv - Immunology 2023Quote: ... During this time in a separate non-binding U well shape plate (Greiner Bio-One, Monroe, NC) competing antibody was diluted to a final concentration of 5 µg/mL in blocking buffer and added to 2 µg/mL GP that was biotinylated through a fused Avi-tag (Avidity ...
-
bioRxiv - Immunology 2024Quote: ... ELISAs were performed as described before.20 96-well high-binding half-area microplates (Greiner or Corning) were coated overnight at 4°C with antigen or capture antibody in PBS (25 μl per well) ...
-
bioRxiv - Bioengineering 2024Quote: ... 50 nM of a different Fab scaffolds were directly immobilized on high binding experimental wells (Greiner Bio) and BSA was immobilized in control wells ...
-
Intra-mitochondrial proteostasis is directly coupled to alpha-synuclein and Amyloid β 1-42 pathologybioRxiv - Neuroscience 2020Quote: SH-SY5Y cells and SH-SY5Y cells overexpressing YFP-alpha-synuclein were cultured in 6 well plates (Greiner Bio-One GmbH) at 350 000 per well ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... They were then transferred into the wells of a 96-well non-binding black microplate (Greiner Bio-One) and the fluorescence was read every 20 minutes at an excitation wavelength of 485nm and an emission wavelength of 520nm using a fluorescence microplate reader (EnVision 2104 Multilabel Reader (Perkin Elmer ...
-
bioRxiv - Neuroscience 2020Quote: ... Reagents used for plate-based immuno-Europium assay were ELISA strip plate (F8, high-binding 771261) from Greiner Bio-One ...
-
bioRxiv - Neuroscience 2020Quote: ... Cells (12,000 cells/well) were plated in 96 well “V” bottom non-binding plates (Greiner Bio-One, #651970) and on day 2 ...
-
bioRxiv - Cancer Biology 2022Quote: All assays were performed at room temperature in low binding black 96-well microtiter plates (Greiner, 655 900) and measured as millipolarization (mP ...
-
bioRxiv - Biophysics 2024Quote: ... All aggregation assays were performed in non-binding 384-well black-walled plates (Greiner Bio-One GmbH, Austria) at 37°C ...
-
bioRxiv - Immunology 2022Quote: ... and 1:750 for Fcγ-receptor binding) overnight at 4°C in 384 well plates (Greiner Bio-One, Germany). Secondary antibodies were PE-conjugated and incubated with samples at room temperature for 1 hour at a 1:100 dilution in sterile-filtered Assay Buffer (1X PBS ...
-
bioRxiv - Neuroscience 2021Quote: 10uM of monomeric Biot-Aβ1-42 in 50mM Tris pH7.4 was pipetted to μclear medium binding half area plates (Greiner, #675096) and ThT was added to a final concentration of 25 μM ...
-
bioRxiv - Biochemistry 2022Quote: ... Ded1p assemblies were transferred to a medium binding Greiner µClear 384 well plate (Greiner Bio-One GmbH, Frickenhausen, Germany). The plates were briefly spun to allow sedimentation of the assemblies before imaging at room temperature.
-
bioRxiv - Immunology 2022Quote: ... and 1:750 for Fcγ-receptor binding) overnight at 4°C in 384 well plates (Greiner Bio-One, Germany). Unbound antibodies were removed by washing and subclasses ...
-
BTK and MMP9 regulate NLRP3 inflammasome-dependent cytokine and NET responses in primary neutrophilsbioRxiv - Immunology 2024Quote: ... ELISAs were performed according to the respective manufacturer’s instructions but using high-binding half-area 96-well plates (Greiner). OD measurements were performed using the Molecular Devices Spectramax plus 384 plate reader ...
-
bioRxiv - Molecular Biology 2023Quote: ... each sample was transferred to a well of a 384-well non-binding microplate (µClear®, Greiner Bio-One) immediately after dilution with low salt buffer and imaged using a Nikon Ti2 inverted microscope with a 60× oil immersion objective ...
-
bioRxiv - Synthetic Biology 2022Quote: ... filled with 200 uL LB medium using sterile tooth picks and incubated overnight at 37°C and 230 rpm and sealed with gas-permeable membrane (BREATHseal™, Greiner Bio-One GmbH). The next day ...
-
bioRxiv - Plant Biology 2024Quote: ... seeds were surface-sterilized in chlorine gas for 3 h and sown on 120-mm square polystyrene petri dishes (Greiner Bio-One, Frickenhausen, DE) containing 0.5x MS salts (Murashige and Skoog ...
-
bioRxiv - Synthetic Biology 2021Quote: ... 47 Assays were performed in 96-well microplate (half area, µCLEAR, black polystyrene, medium binding, non-sterile, Greiner Bio-One) with NADH fluorescence (λEx = 340 nm ...
-
bioRxiv - Biophysics 2020Quote: ... The samples were mixed by pipetting and 18 μl were transferred into 384 well medium-binding microplates (Greiner bio-one). The samples were incubated at RT for 20 min prior to imaging ...
-
bioRxiv - Neuroscience 2021Quote: The mixtures of Aβ1-42 and the peptides were pipetted to a μclear medium binding half area plates (Greiner, #675096) and ThT was added to a final concentration of 25 μM ...
-
bioRxiv - Immunology 2020Quote: ... mybiosource TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSM FGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK) or vehicle (PBS or chloroform) were plated on a high binding 96 well flat-bottomed plate (Greiner) and left at RT overnight ...
-
bioRxiv - Microbiology 2022Quote: ... Assays were performed in 20 μL volume in 384-well Non-binding Low-volume plates (Greiner Bio-One; Monroe, NC) at ambient temperature ...
-
bioRxiv - Developmental Biology 2022Quote: ... hiPSCs were plated at 10,000 cells per well in V-bottom 96-well low-cell-binding plates (Greiner Bio-One) in DB27 medium (DMEM/F12 HEPES ...
-
bioRxiv - Neuroscience 2022Quote: ... Thirty microliters of 1 μM human PrP23–111 (10 mM sodium carbonate, pH 9.6) was bound to high binding 384-well white plates (Greiner #G781074) with shaking at 400 RPM for 1 h at 37 °C ...
-
bioRxiv - Microbiology 2024Quote: ... at an excitation wavelength of 488 nm and an emission wavelength of 675 nm (50 nm bandwidth) and Black 1536-well flat bottom small volume microplates with a non-binding surface from Greiner Bio-One GmbH (Frickenhausen ...
-
bioRxiv - Microbiology 2024Quote: ... virus solutions were manually mixed immediately prior to deposition of 1 μL droplets on open 96-well plates (non-binding microplates, flat-bottom, transparent, Greiner Bio-One ...
-
bioRxiv - Neuroscience 2024Quote: ... was coated overnight at a concentration of 1 µg/mL on a 96-well high binding half area plate (Greiner). The following day ...
-
bioRxiv - Microbiology 2024Quote: ... three 1 μL droplets were deposited into individual wells of a 96-well non-binding microplate (#655901, Greiner Bio-One). The last deposited set of droplets was immediately collected (t=0 ...
-
bioRxiv - Cancer Biology 2021Quote: The assays were performed at room temperature using assay buffer (PBS, pH 7.4, 0.01% v/v Tween 20) and black 384-well non-binding polystyrene microplate (Greiner Bio-one, #784900). The peptide of interest was first diluted (10-point ...
-
bioRxiv - Molecular Biology 2022Quote: ... The assay samples (total volume 100 μL) were mixed in a black non-binding 96-well plate (Greiner Bio-One, Switzerland). The plate was sealed (Nunc™ ...
-
bioRxiv - Biochemistry 2021Quote: Measurements were taken in a 96-well black plate (Microplate 96 Well PS F-Bottom Black Non-Binding, Greiner Bio-one) using a TECAN M1000 Pro ...
-
bioRxiv - Bioengineering 2023Quote: ... All binding assays were performed with six replicates and carried out in 0.2 mL 96-well round bottom microplates (Greiner Bio-One) with crystalline cellulose (Avicel PH-101 ...
-
bioRxiv - Microbiology 2024Quote: ... (MP Biomedical) in coating buffer (100 mM Na2CO3/NaHCO3, pH 9.6) was immobilized on a high-binding ELISA plate (Greiner Bio-One). To assess dose- dependent BG inhibition ...