Labshake search
Citations for New England Biolabs :
301 - 350 of 2108 citations for Puumala Virus Glycoprotein 2 Gc Human Heterodimeric Fc tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2020Quote: Sec24D was subcloned from pEGFP Sec24D into pcDNA3.1 with an N-terminal myc-6xHis tag using Gibson Assembly (E5510, New England Biolabs). pcDNA3.1 was linearized with Not1 (R3189 ...
-
bioRxiv - Biophysics 2020Quote: ... with TEV-cleavable 6x-His tag at N-terminal of the gene cloned between NheI (New England Biolabs Inc.) and HindIII (New England Biolabs Inc. ...
-
bioRxiv - Microbiology 2021Quote: ... DGRC) downstream of and in-frame with the 3X FLAG tag using Gibson assembly (HiFi DNA assembly mix, NEB). Expression of FLAG-tagged DNMT2 in fly cells was confirmed using qRT-PCR and Western Blots using an anti-FLAG monoclonal antibody (SAB4301135 - Sigma-Aldrich ...
-
bioRxiv - Genomics 2022Quote: ... Two nested single-tail adapter/tag (STAT)-PCR [29] were performed with LongAmp Hot Start Taq polymerase (NEB, M0533S) using adaptor binding P5_1 and P5_2 primers and corresponding insert primer pairs (see Supplementary Table 2) ...
-
bioRxiv - Biochemistry 2022Quote: ... The N-linked glycans and the CBP tag were cleaved by endoglycosidase H (Endo H, ∼0.2 mg per 10–15 mg purified protein, New England Biolabs) and HRV-3C protease (∼2 mg per 10–15 mg purified proteins ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... Cells were labelled with the cleavable SNAP-tag probe BG-S-S-549 (a gift from New England Biolabs) in complete medium for 30 min at room temperature ...
-
bioRxiv - Cell Biology 2019Quote: The fluorescent SNAP-tag substrate BG-CF640R was synthesized by amidization reaction of BG-NH2 (New England Biolabs #S9148S) and CF640R-NHS ester (Biotium #92108) ...
-
bioRxiv - Microbiology 2021Quote: ... downstream of and in-frame with the 3X FLAG tag using the native restriction sites AgeI and NheI (NEB). Expression of both FLAG-tagged AaDNMT2 in mosquito cells was confirmed using qRT-PCR and Western Blots using an anti-FLAG monoclonal antibody (SAB4301135 - Sigma-Aldrich ...
-
bioRxiv - Molecular Biology 2021Quote: ... a Hisx6 sequence tag was inserted into the BamH1 and Xho1 sites of MCS2 of pSNAPf (New England Biolabs) to create pSNAPf_Hisx6 ...
-
bioRxiv - Molecular Biology 2020Quote: ... pET28a-6xHis-MBP-Tev cleavage site-mGFP-FUS-TIS-Strep-tag II was transformed into BL21 E.coli (New England Biolabs). Two fresh colonies were cultivated overnight in 2 × 50 ml SOB medium at 37 °C ...
-
bioRxiv - Molecular Biology 2021Quote: ... a Hisx6 sequence tag was inserted into the BamH1 and Xho1 sites of MCS2 of pSNAPf (New England Biolabs) to create pSNAPf_Hisx6 ...
-
bioRxiv - Molecular Biology 2022Quote: ... 404–561 with a C terminal His tag added was cloned into the pMAL-c5x vector (New England Biolabs), and were transformed in E ...
-
Transport of metformin metabolites by guanidinium exporters of the Small Multidrug Resistance familybioRxiv - Biophysics 2023Quote: ... histidine tags were cleaved with LysC (200 ng/mg of protein; two hours at room temperature; New England Biolabs), and for all others ...
-
bioRxiv - Biophysics 2023Quote: ... into a pSGEM construct with five consecutive repeats of the myc tag (Lörinczi et al., 2015) using NcoI and HindIII (New England Biolabs).
-
bioRxiv - Biochemistry 2023Quote: ... the HA-epitope was replaced by a 6xHis tag using the Q5 Site Directed Mutagenesis Kit (New England Biolabs) to generate Ptch1 KR-His ...
-
bioRxiv - Biophysics 2022Quote: ... The C-terminal Flag tag was introduced into pcDNA3.1-Spike-WT thanks to NEBuilder® HiFi DNA Assembly (NEB). The Flag tag was added during amplification of Spike-WT from pcDNA3.1-Spike-WT with the primers ...
-
bioRxiv - Bioengineering 2023Quote: ... cells were incubated in dye solution (1 μM SNAP-tag ligand BG-AF647 (catalog no. S9136S, New England Biolabs), 1 mM DTT (catalog no ...
-
bioRxiv - Biophysics 2023Quote: ... cells were incubated in dye solution (1 μM SNAP-tag ligand BG-AF647 (catalog no. S9136S, New England Biolabs), 1 mM dithiothreitol (catalog no ...
-
bioRxiv - Cell Biology 2024Quote: ... MBP tags that co-eluted with NTF2L proteins were purified by incubating with amylose resin (New England BioLabs, #E8021L) overnight at 4°C and collecting the flow through the following day ...
-
bioRxiv - Biophysics 2020Quote: ... from human origin were all purchased from NEB. The H2A/H2B and H3.1/H4 were mixed in 2(H2A/H2B)2:1(H3/H4)4 molar ratio to form octamers.
-
bioRxiv - Molecular Biology 2021Quote: ... Recombinant human histone H4 (New England Biolabs # M2504S) was used as a substrate ...
-
bioRxiv - Neuroscience 2021Quote: ... One μg of RNA was reverse transcribed in a 20 μl reaction using Moloney Murine Leukemia Virus Reverse Transcriptase (New England Biolabs, Evry, France) and random primers and cDNA obtained amplified using Q5® DNA Polymerase (New England Biolabs ...
-
bioRxiv - Zoology 2023Quote: ... One μg of total RNA was reverse transcribed in a 20 μl reaction using Moloney murine leukemia virus reverse transcriptase (New England Biolabs, Evry, France) and random primers ...
-
bioRxiv - Bioengineering 2021Quote: ... 2 μL of 2 U L-1 ExoI (NEB) was added and incubated at 37 °C for 30 minutes then 80 °C for 20 minutes ...
-
bioRxiv - Biochemistry 2020Quote: ... 2 μL of GlycoBuffer 2 (NEB Cat # B0701S, 10X), 2 μL of 10% NP-40 (NEB Cat # B0701S ...
-
bioRxiv - Systems Biology 2024Quote: ... 2 µl of NEBuffer 2 (New England Biolabs B7002) and 1 µl of Klenow large fragment DNA polymerase (New England Biolabs M0210 ...
-
bioRxiv - Biophysics 2021Quote: ... 1mM DTT) were put on ice and mixed with SNAP-tag fluorophores (SNAP-Surface 549 purchased from New England Biolabs) dissolved in DMSO and 0.1% Tween-20 ...
-
bioRxiv - Biophysics 2021Quote: ... The AcrIIA4 expression vector was modified to express AcrIIA11 with a C-terminal NLS and HA tags using the HiFi Assembly Kit (NEB).
-
bioRxiv - Molecular Biology 2020Quote: ... with primers to introduce BamHI and NotI sites and cloned into pcDNA4/TO-3xFLAG (C-terminal tag) using T4 DNA ligase (New England Biolabs). pcDNA4/TO-ORF24 202-752-3xFLAG (Addgene #138424 ...
-
bioRxiv - Genetics 2021Quote: ... NbVHH05/Nb127D01 PCR fragments with HA tag were cloned into pET-26b (NcoI, NEB, R3193 and XhoI, NEB, R0146 digested) by HiFi assembly.
-
bioRxiv - Genetics 2021Quote: ... NbVHH05/Nb127D01 PCR fragments with HA tag were cloned into pET-26b (NcoI, NEB, R3193 and XhoI, NEB, R0146 digested) by HiFi assembly.
-
bioRxiv - Biochemistry 2021Quote: ... The 3xHA epitope tag in the knock-in construct was replaced by a 3xFlag epitope tag using the Q5 site-directed mutagenesis kit (NEB). The newly generated knock in sequence was amplified in a multi-step PCR reaction adding the terminator sequence from the pEv200 plasmid and BssHI and HindIII restriction site ...
-
bioRxiv - Developmental Biology 2021Quote: A plasmid encoding mouse ADAMTS6 with a C-terminal myc/his tag was generated previously (31) and used for site-directed mutagenesis (Q5 Site-Directed Mutagenesis Kit; E0554; New England BioLabs) to introduce Ala at Glu404 ...
-
bioRxiv - Biochemistry 2022Quote: ... trcP or fragments of the trcP ORF were cloned into pHL100’s SmaI site with the 23 nt upstream sequence and the Flag tag sequence on the C-terminal using NEBuilder HiFi DNA Assembly Master Mix (NEB); subsequently ...
-
bioRxiv - Microbiology 2022Quote: ... of the SNAP-Tag-SCE-I-KanR shuttle sequence with a nine amino acid linker (HTEDPPVAT) and subsequent second recombination to clear the Kanamycin resistance and restore the SNAP-Tag sequence (NEB; for complete insertion sequence see Table 1) ...
-
bioRxiv - Biochemistry 2022Quote: ... a cysteine was added to the N-terminus of the coding sequence directly after the precision protease recognition site or after the six-histidine tag on the C-terminus using the Q5 Site-Directed Mutagenesis Kit (New England Biolabs).
-
bioRxiv - Molecular Biology 2019Quote: ... The HIS-SUMO-BAHEPR-1 fusion and HIS-SUMO tag constructs were expressed in Escherichia coli BL21 DE3 cells (New England BioLabs). Both HIS-SUMO-BAHEPR-1 and HIS-SUMO cultures were initially grown in 4 liters of LB media at 37 °C at 200 RPM until cultures reached an optical density of ∼ 1.0 at 600 nm and then cultures were pelleted ...
-
bioRxiv - Cell Biology 2019Quote: ... A FLAG-tag (DYKDDDDK tag) followed by a stop codon was then inserted using the Q5 Site-Directed Mutagenesis Kit (New England BioLabs) according to manufacturer protocols ...
-
bioRxiv - Bioengineering 2019Quote: ... inserting a N-terminal TEV cleavage tag and cloned into a pET28a backbone in front of the His-tag using the NEBuilder HiFi DNA assembly method (NEB).
-
bioRxiv - Bioengineering 2019Quote: ... the 720 bp Cerulean cassette between the AgeI/HpaI sites of pPPIA-Cer-Fib was replaced with a 560 bp SNAP tag fragment PCR amplified from plasmid pSNAPf (New England Biolabs) using primer pair Snap-XmaI-For/Snap-HpaI-Fib-Rev and double digested with XmaI/HpaI ...
-
bioRxiv - Biochemistry 2020Quote: Expressed proteins were purified using the intein-mediated purification and affinity chitin-binding tag (IMPACT) chitin affinity matrix system (New England Biolabs). A cell pellet was dissolved in 8 mL of column buffer (20 mM Tris-HCl ...
-
bioRxiv - Cell Biology 2021Quote: ... Plasmids to express Flag-tagged and HA-tagged proteins were created by changing the Myc-coding sequence in pCMV-Myc expression plasmids to intended tag-coding sequence using inverse PCR and NE Builder HiFi Assembly (New England BioLabs), respectively.
-
bioRxiv - Neuroscience 2020Quote: ... C-terminal Myc tag of the biosensor and GFP were carried out with Q5 Site-Directed Mutagenesis Kit (New England Biolabs). The plasmid encoding this engineered periplasmic acetylcholine-binding protein (sequence MHHHHHHGGAQPARSANDTVVVGSIIFTEGIIVANMVAEMIEAHTDLKVVRKLNLGGV NVNFEAIKRGGANNGIDIYVEYTGHGLVDILGFPATTDPEGAYETVKKEYKRKWNIVWL KPLGFNNTYTLTVKDELAKQYNLKTFSDLAKISDKLILGATMFFLEGPDGYPGLQKLYN FKFKHTKSMDMGIRYTAIDNNEVQVIDAWATDGLLVSHKLKILEDDKAFFPPYYAAPIIR QDVLDKHPELKDVLNKLANQISLEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLILQVD ...
-
bioRxiv - Biochemistry 2021Quote: AcpP was expressed from a pET28a plasmid encoding acpP with a thrombin-cleavable N-terminal 6xHis tag in C3031I cells (NEB). 2L cultures of LB supplemented with kanamycin (25 μg/mL ...
-
bioRxiv - Plant Biology 2020Quote: ... and uvr8-17D genotyping was through PCR amplification of a genomic fragment with a forward (5ʹ-TCG GGA TGA GAT GAT GAC-3ʹ) and a reverse primer (5ʹ-TAG ACC CAA CAT TGA CCC-3ʹ) followed by digestion with HaeIII (NEB) yielding diagnostic fragments of 344/173/145 bp for wild type and 489/173 bp for uvr8-17D.
-
bioRxiv - Microbiology 2020Quote: ... A bacteria-codon optimized gBlock for the truncated protein was produced by IDT DNA Technologies and cloned into a pET28a bacterial expression with a C-terminal 6xHis tag using the NEBuilder Assembly Kit (New England Biolabs). Recombinant protein was expressed in BL21(DE3 ...
-
bioRxiv - Microbiology 2021Quote: ... which were incubated with 1 μg/ml full-length S protein with His tag that had been pretreated with or without FXa (P8010L, NEB) for 2 hours at room temperature ...
-
bioRxiv - Microbiology 2019Quote: ... myc epitope tag insertion and TEXEL2 point mutations were introduced into pTub-Gra44-HPT using the Q5 site directed mutagenesis kit (NEB) and TEXEL point mutations were accomplished similarly with Quikchange site-directed mutagenesis kit (Agilent).
-
bioRxiv - Cell Biology 2021Quote: ... and cloned into the pZE13d vector (Lutz and Bujard, 1997) with an N-terminal 6xHis tag via Gibson assembly (Hifi DNA Assembly, NEB) using ClaI and PstI restriction sites ...
-
bioRxiv - Biochemistry 2022Quote: ... open reading frames were cloned into a linearized pET28b vector with BamH1 and Xho1 in frame with a N- terminal 6x-His tag using Gibson HiFi assembly mix (NEB), 10 μL total reaction volume with 2 μL of linearized vector ...