Labshake search
Citations for New England Biolabs :
301 - 350 of 574 citations for Human MOG His tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2021Quote: ... GST aPKC PBM and his aPKC kinase domain-PBM (residues 259-606) were cloned as previously described (10) using Gibson cloning (New England BioLabs), Q5 mutagenesis (New England BioLabs ...
-
bioRxiv - Genetics 2019Quote: ... The donor sequence was generated by subcloning 596 bp upstream of the hrpk-1 stop codon and 600 bp downstream of hrpk-1 stop codon into the pDD282 vector [45] using Hi Fi assembly kit (NEB). The hrpk-1 stop codon was eliminated from the donor sequence to allow in frame GFP tag addition ...
-
bioRxiv - Synthetic Biology 2020Quote: ... Insert NGRP or scFv13R4 was assembled into backbone pDEST-ORS-PelB TMT following NEB builder Hi-fi mix protocol (NEB) to create pDEST-ORS-NGRP/scFv13R4 TMT ...
-
bioRxiv - Microbiology 2021Quote: ... and cloned to the C terminus of a 11 His-tagged maltose-binding protein in a pMAL-C5X vector (New England Biolabs) separated by a cleavage site for tobacco etch virus protease ...
-
bioRxiv - Cell Biology 2022Quote: ... EIF2AK2 and EIF2S1 sequences were inserted into pET-His 1a vector using the Gibson Assembly Cloning Kit (New England Biolabs) as described by the manufacturer.
-
bioRxiv - Cell Biology 2021Quote: ... and ligated to linearized vector pGex-6p-1 (GST) or pET28-SUMO (His) also cut with the same restriction enzymes using T4 DNA ligase (NEB).
-
bioRxiv - Molecular Biology 2022Quote: ... The Hi-C library for Illumina sequencing was prepared with the NEBNext Ultra II DNA Library Prep Kit for Illumina (NEB) according to the manufacturer’s instructions ...
-
bioRxiv - Biochemistry 2022Quote: ... a tolerant position was mutated to facilitate making a labeled LexA variant.56 The His-LexA W201C mutant was generated using a Q5 Site-Directed Mutagenesis Kit (NEB) and the mutation was confirmed via sequencing ...
-
bioRxiv - Cell Biology 2022Quote: ... The resultant adaptor-ligated Hi-C library was amplified by PCR with five to seven cycles with Q5 master mix (M0544, NEB) and index primers (E7335/E7500/E7710/E7730 ...
-
bioRxiv - Evolutionary Biology 2022Quote: ebony non-coding regions from different species were amplified via PCR and cloned into the S3AG vector using NEBuilder Hi-Fi DNA assembly (NEB) (Table X) ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... melanogaster strain to be injected and inserted into plasmids containing fluorescent eye markers using NEBuilder Hi-Fi DNA assembly (NEB). See key resources table for primers sequences and donor plasmids.
-
bioRxiv - Microbiology 2023Quote: ... was used as a template for in vitro transcription using Hi-T7 RNA Polymerase and Ribonucleotide Solution Mix (both from New England Biolabs) in accordance with the manufacturer’s instructions ...
-
bioRxiv - Developmental Biology 2022Quote: ... Libraries were amplified for 12 PCR cycles with unique dual index primers using the NEBNext Hi-Fi 2X PCR Master Mix (New England Biolabs). Amplified libraries were purified using a 1.2X ratio of Axygen magnetic beads (Corning Inc ...
-
bioRxiv - Developmental Biology 2023Quote: ... Supernatants were separated from lysates and incubated with affinity beads at 4°C overnight (His beads: Ni-NTA from QIAGEN; GST beads: glutathione-agarose beads from ROTH; MBP beads: amylose beads from NEB). Protein-binding beads were collected by centrifugation and washed several times with washing buffer (His washing buffer ...
-
bioRxiv - Genetics 2023Quote: ... The final cleaned-up Hi-C library was used as input material for Illumina sequencing library prep kit (NEB, E7805) with 6-8 cycles of PCR amplification using KAPA-HiFi (Kapa Biosystems ...
-
bioRxiv - Microbiology 2023Quote: ... The insert was amplified using MRSN390231 overnight culture as a DNA template and joined with linearized pUC18-mini-Tn7T-LAC vector using Hi-Fi DNA Gibson Assembly (NEB) following the manufacturer’s protocol ...
-
bioRxiv - Microbiology 2023Quote: ... Inserts were amplified by PCR using bacterial overnight culture or synthesized by Twist Bioscience and joined with the digested vector using Hi-Fi DNA Gibson Assembly (NEB) following the manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2023Quote: ... was used in sequential reverse transcription and PCR amplification steps using the Protoscript II first strand cDNA synthesis kit and Q5 Hi-fidelity DNA polymerase (NEB) according to manufacturer’s protocols ...
-
bioRxiv - Pharmacology and Toxicology 2024Quote: ... linker was inserted into the pC13N-iCAG.copGFP vector through BsrGI and MluI digestion and Hi-T4™ ligation (Cat.#M2622; New England Biolabs), thus replacing copGFP and generating the pC13N_N-HiBiT plasmid ...
-
bioRxiv - Cancer Biology 2024Quote: ... by PCR amplification with the indicated primers (Key Resources table) followed by a digestion with Bam HI and Xba I enzymes (New England Biolabs) for 37°C 2 h ...
-
bioRxiv - Microbiology 2024Quote: ... Inserts were amplified by PCR from diluted ΦKZ lysates and joined into the linearized vector by Hi-Fi DNA Assembly (NEB). The resulting vectors were used to transform E ...
-
Bacteria Are a Major Determinant of Orsay Virus Transmission and Infection in Caenorhabditis elegansbioRxiv - Microbiology 2024Quote: ... homology arms flanking the region to be deleted were obtained using polymerase chain reaction (PCR) and cloned into the pExG2-KanR suicide vector using Hi-Fi Assembly (New England Biolabs)70 ...
-
bioRxiv - Biochemistry 2023Quote: Purified CBC or CBC-ARS2147-871 and their mixtures with different His-MBP-tagged partners were loaded onto Amylose resin columns (NEB). Columns were then extensively washed with a buffer containing 100 mM Tris pH 8 ...
-
bioRxiv - Biophysics 2021Quote: ... 1mM DTT) were put on ice and mixed with SNAP-tag fluorophores (SNAP-Surface 549 purchased from New England Biolabs) dissolved in DMSO and 0.1% Tween-20 ...
-
bioRxiv - Biophysics 2021Quote: ... The AcrIIA4 expression vector was modified to express AcrIIA11 with a C-terminal NLS and HA tags using the HiFi Assembly Kit (NEB).
-
bioRxiv - Molecular Biology 2020Quote: ... with primers to introduce BamHI and NotI sites and cloned into pcDNA4/TO-3xFLAG (C-terminal tag) using T4 DNA ligase (New England Biolabs). pcDNA4/TO-ORF24 202-752-3xFLAG (Addgene #138424 ...
-
bioRxiv - Molecular Biology 2020Quote: ... Plasmids encoding HA-tagged LC3B proteins were generated by replacing the EGFP sequence in the EGFP plasmids with an HA-tag followed by a Tobacco etch virus protease sequence recognition site and a Flag-Tag (Genewiz) using AgeI and HindIII (New England Biolabs). Lipidation-deficient LC3B proteins were generated by mutagenic PCR using Q5 Hot Start High-Fidelity Master Mix (New England Biolabs ...
-
bioRxiv - Genetics 2021Quote: ... NbVHH05/Nb127D01 PCR fragments with HA tag were cloned into pET-26b (NcoI, NEB, R3193 and XhoI, NEB, R0146 digested) by HiFi assembly.
-
bioRxiv - Genetics 2021Quote: ... NbVHH05/Nb127D01 PCR fragments with HA tag were cloned into pET-26b (NcoI, NEB, R3193 and XhoI, NEB, R0146 digested) by HiFi assembly.
-
bioRxiv - Biochemistry 2021Quote: ... The 3xHA epitope tag in the knock-in construct was replaced by a 3xFlag epitope tag using the Q5 site-directed mutagenesis kit (NEB). The newly generated knock in sequence was amplified in a multi-step PCR reaction adding the terminator sequence from the pEv200 plasmid and BssHI and HindIII restriction site ...
-
bioRxiv - Developmental Biology 2021Quote: A plasmid encoding mouse ADAMTS6 with a C-terminal myc/his tag was generated previously (31) and used for site-directed mutagenesis (Q5 Site-Directed Mutagenesis Kit; E0554; New England BioLabs) to introduce Ala at Glu404 ...
-
bioRxiv - Biochemistry 2022Quote: ... trcP or fragments of the trcP ORF were cloned into pHL100’s SmaI site with the 23 nt upstream sequence and the Flag tag sequence on the C-terminal using NEBuilder HiFi DNA Assembly Master Mix (NEB); subsequently ...
-
bioRxiv - Microbiology 2022Quote: ... of the SNAP-Tag-SCE-I-KanR shuttle sequence with a nine amino acid linker (HTEDPPVAT) and subsequent second recombination to clear the Kanamycin resistance and restore the SNAP-Tag sequence (NEB; for complete insertion sequence see Table 1) ...
-
bioRxiv - Biochemistry 2022Quote: ... a cysteine was added to the N-terminus of the coding sequence directly after the precision protease recognition site or after the six-histidine tag on the C-terminus using the Q5 Site-Directed Mutagenesis Kit (New England Biolabs).
-
bioRxiv - Molecular Biology 2021Quote: A CD22 cDNA fragment encoding the first two Ig-like domains fused to an EK-hIgG-Fc fragment was amplified by PCR and cloned into the mammalian expression vector pACP-tag(m)-2 (New England Biolabs).
-
bioRxiv - Molecular Biology 2019Quote: ... followed by the insertion of a DNA fragment containing C-terminal 2×HA tag by NEBuilder HiFi DNA Assembly Master Mix (NEB). Finally ...
-
bioRxiv - Cell Biology 2019Quote: ... A FLAG-tag (DYKDDDDK tag) followed by a stop codon was then inserted using the Q5 Site-Directed Mutagenesis Kit (New England BioLabs) according to manufacturer protocols ...
-
bioRxiv - Bioengineering 2019Quote: ... the 720 bp Cerulean cassette between the AgeI/HpaI sites of pPPIA-Cer-Fib was replaced with a 560 bp SNAP tag fragment PCR amplified from plasmid pSNAPf (New England Biolabs) using primer pair Snap-XmaI-For/Snap-HpaI-Fib-Rev and double digested with XmaI/HpaI ...
-
bioRxiv - Biochemistry 2021Quote: pMAL-c4E vectors carrying in-frame fusions of the EFR cytoplasmic domain with the N-terminal maltose-binding protein (MBP) tag were transformed into Rosetta 2 cells (NEB) for recombinant protein expression ...
-
bioRxiv - Biochemistry 2020Quote: Expressed proteins were purified using the intein-mediated purification and affinity chitin-binding tag (IMPACT) chitin affinity matrix system (New England Biolabs). A cell pellet was dissolved in 8 mL of column buffer (20 mM Tris-HCl ...
-
bioRxiv - Cell Biology 2021Quote: ... Plasmids to express Flag-tagged and HA-tagged proteins were created by changing the Myc-coding sequence in pCMV-Myc expression plasmids to intended tag-coding sequence using inverse PCR and NE Builder HiFi Assembly (New England BioLabs), respectively.
-
bioRxiv - Neuroscience 2020Quote: ... C-terminal Myc tag of the biosensor and GFP were carried out with Q5 Site-Directed Mutagenesis Kit (New England Biolabs). The plasmid encoding this engineered periplasmic acetylcholine-binding protein (sequence MHHHHHHGGAQPARSANDTVVVGSIIFTEGIIVANMVAEMIEAHTDLKVVRKLNLGGV NVNFEAIKRGGANNGIDIYVEYTGHGLVDILGFPATTDPEGAYETVKKEYKRKWNIVWL KPLGFNNTYTLTVKDELAKQYNLKTFSDLAKISDKLILGATMFFLEGPDGYPGLQKLYN FKFKHTKSMDMGIRYTAIDNNEVQVIDAWATDGLLVSHKLKILEDDKAFFPPYYAAPIIR QDVLDKHPELKDVLNKLANQISLEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLILQVD ...
-
bioRxiv - Biochemistry 2021Quote: AcpP was expressed from a pET28a plasmid encoding acpP with a thrombin-cleavable N-terminal 6xHis tag in C3031I cells (NEB). 2L cultures of LB supplemented with kanamycin (25 μg/mL ...
-
bioRxiv - Plant Biology 2020Quote: ... and uvr8-17D genotyping was through PCR amplification of a genomic fragment with a forward (5ʹ-TCG GGA TGA GAT GAT GAC-3ʹ) and a reverse primer (5ʹ-TAG ACC CAA CAT TGA CCC-3ʹ) followed by digestion with HaeIII (NEB) yielding diagnostic fragments of 344/173/145 bp for wild type and 489/173 bp for uvr8-17D.
-
bioRxiv - Immunology 2021Quote: ... Two restriction sites NheI at the 5’ end and BamHI at the 3’ end were incorporated into the CD4-polypeptide linker plasmid which was then inserted into pACP-tag(m)-2 plasmid (New England Biolabs) to obtain pACP-CD4 ...
-
bioRxiv - Microbiology 2020Quote: ... A bacteria-codon optimized gBlock for the truncated protein was produced by IDT DNA Technologies and cloned into a pET28a bacterial expression with a C-terminal 6xHis tag using the NEBuilder Assembly Kit (New England Biolabs). Recombinant protein was expressed in BL21(DE3 ...
-
bioRxiv - Microbiology 2019Quote: ... myc epitope tag insertion and TEXEL2 point mutations were introduced into pTub-Gra44-HPT using the Q5 site directed mutagenesis kit (NEB) and TEXEL point mutations were accomplished similarly with Quikchange site-directed mutagenesis kit (Agilent).
-
bioRxiv - Cell Biology 2021Quote: ... and cloned into the pZE13d vector (Lutz and Bujard, 1997) with an N-terminal 6xHis tag via Gibson assembly (Hifi DNA Assembly, NEB) using ClaI and PstI restriction sites ...
-
bioRxiv - Biophysics 2020Quote: ... The construct was amplified by PCR and inserted into pSNAP-tag®(T7)-2 vector (New England Biolabs Inc. #N9181S) with a SNAPf-EGFP-6His cassette ...
-
bioRxiv - Biochemistry 2022Quote: ... The library was cloned into a pENTR1A plasmid backbone with a C-terminal YFP HA reporter tag using Gibson Assembly (HiFi DNA Assembly Cloning Kit, New England Biolabs, (NEB), Ipswich ...