Labshake search
Citations for New England Biolabs :
6601 - 6650 of 9715 citations for Human Transcription factor HIVEP2 HIVEP2 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
Safety and efficacy of C9ORF72-repeat RNA nuclear export inhibition in amyotrophic lateral sclerosisbioRxiv - Systems Biology 2021Quote: ... Dual-indexed strand-specific RNA-seq library were prepared from the submitted total RNA samples using RiboZero rRNA depletion and the NEBNext Ultra Directional RNA library preparation kits (New England Biolabs). Paired-end 2×150bp sequencing was performed on an Illumina HiSeq 4000 platform ...
-
bioRxiv - Biochemistry 2021Quote: ... which we used to construct the D614G mutant via site directed mutagenesis (Q5 Site-Directed Mutagenesis Kit, New England Biolabs).
-
bioRxiv - Biochemistry 2021Quote: ... K4A with K3WA) mutants of the full-length RAD51AP1 protein were generated by Q5 Site-Directed Mutagenesis kit (New England Biolabs) following the instructions of the manufacturer and the primer pairs listed in Table 1.
-
bioRxiv - Biochemistry 2020Quote: ... The mRNA was then adapter ligated and prepared for Illumina sequencing using the Ultra Directional RNA Library Prep Kit (NEB).
-
bioRxiv - Bioengineering 2021Quote: ... the reporter gene GFP was replaced with mScarlet using the NEBuilder HiFi DNA Assembly kit (New England BioLabs catalog number:E5510S), to produce two different expression vectors.
-
bioRxiv - Bioengineering 2021Quote: ... were either synthesized or PCR-amplified and then cloned into the px552-U6-CAG-mCherry plasmid using an NEBuilder HiFi DNA assembly kit (NEB). The AAV vectors were then sent to VectorBuilder Inc (Chicago ...
-
bioRxiv - Bioengineering 2021Quote: ... were PCR-amplified using primers listed in Supplementary Table 7 and cloned into the px601 plasmid using an NEBuilder HiFi DNA assembly kit (NEB). Similarly ...
-
bioRxiv - Bioengineering 2020Quote: ... We added 1 μL of the resulting DNase digestions to 10 μL RT-qPCR reactions (Luna One-Step Universal RT-qPCR Kit, New England Biolabs) containing 0.8 U/μL RNasin Plus (Promega ...
-
bioRxiv - Bioengineering 2020Quote: ... We performed assays for the E and RNase P genes separately in 20 μL reaction volumes using the Luna Universal Probe One-Step RT-qPCR Kit (New England Biolabs). The final concentrations of primer and probe were 400 and 200 nM ...
-
bioRxiv - Biochemistry 2020Quote: ... Libraries were prepared using the NEBNext Ultra II DNA Library Prep Kit for Illumina (New England BioLabs, Ipswich, MA, USA). Paired-end 100bp reads were performed on an Illumina HiSeq4000 ...
-
Long-Range Electrostatic Interactions Significantly Modulate the Affinity of Dynein for MicrotubulesbioRxiv - Biophysics 2021Quote: ... We mutated aspartic acid 3420 to alanine (D3420A) and glutamic acid 3320 to alanine (E3320A) using a Q5 site-directed mutagenesis kit (E0552S, New England Biolabs, Ipswich ...
-
bioRxiv - Microbiology 2021Quote: ... RNA was eluted in RNase-free water and subsequently treated with Turbo DNase and purified using the Monarch RNA Cleanup Kit (50 µg) (NEB) and eluted in RNase-free water ...
-
bioRxiv - Neuroscience 2020Quote: ... Total RNA was extracted from the heads of 20 male adults or 17 female adults using a Monarch Total RNA Miniprep Kit (NEB). 3 replicates for male and 3 replicates for female flies were done for each genotype ...
-
bioRxiv - Neuroscience 2020Quote: ... cDNA libraries were made from RNA using NEB’s Next Single Cell/Low Input RNA Library Prep Kit for Illumina (NEB E6420). Libraries were sequenced on an Illumina HiSeq 4000 with single reads of 50 bases.
-
bioRxiv - Microbiology 2021Quote: ... qRT-PCR was performed from 1µL of template RNA in a final volume of 5 μL per reaction in 384-well plates using the Luna Universal Probe One-Step RT-qPCR Kit (New England Biolabs) with SARS-CoV-2 N-specific primers (EV Table 1 ...
-
bioRxiv - Microbiology 2021Quote: ... The amino acid deletions in the full-length SARS-CoV-2 Spike expressor were generated using the Q5 site-directed mutagenesis kit (NEB). The presence of the desired mutations was determined by automated DNA sequencing ...
-
bioRxiv - Molecular Biology 2021Quote: ... cut sites found in the primers and cloned into a pcDNA3.1(+) backbone using the Quick Ligation Kit (New England Biolabs M2200). Plasmids were transformed and grown in subcloning efficiency DH5α competent cells (Invitrogen # 18265017 ...
-
bioRxiv - Cancer Biology 2021Quote: ... Trp53 point mutations were introduced using site-directed mutagenesis with the Q5 Site-Directed Mutagenesis Kit (New England Biolabs E0552S). Retrovirus was produced by plasmid transfection into Platinum-E (Plat-E ...
-
bioRxiv - Cancer Biology 2021Quote: ... This NUP210 insert was then cloned into the Gateway entry vector pENTR1A using the Quick Ligation Kit (New England Biolabs). pENTR1A no ccdB plasmid (Addgene plasmid # 17398 ...
-
bioRxiv - Cell Biology 2021Quote: ... The procedure of the complementary DNA (cDNA) libraries was carried out with NEBNext Ultra II RNA library Prep kit (NEB) and NEBNextplex Oligos for Illumina following a previously described method (Kohno et al. ...
-
bioRxiv - Cell Biology 2021Quote: ... A 12xHis tag was cloned into the N-terminus of pcDNA3.1-MICAL1-FLAG using Q5® Site-Directed Mutagenesis Kits (New England BioLabs) according to the manufacturer’s protocol ...
-
BRD2 inhibition blocks SARS-CoV-2 infection by reducing transcription of the host cell receptor ACE2bioRxiv - Cell Biology 2021Quote: ... PCR was carried out in a final volume of 5 μL per reaction in 384-well plates using the Luna Universal Probe One-Step RT-qPCR Kit (New England Biolabs) with SARS-CoV-2 N-specific primers (Forward 5′-TAA TCA GAC AAG GAA CTG ATT A-3′ ...
-
BRD2 inhibition blocks SARS-CoV-2 infection by reducing transcription of the host cell receptor ACE2bioRxiv - Cell Biology 2021Quote: ... 5′-TAATCAGACAAGGAACTGATTA-3′ (Forward) and 5′-CGAAGGTGTGACTTCCATG-3′ (Reverse) were used with the Luna Universal One-Step RT-qPCR Kit (New England Biolabs) in an Applied Biosystems QuantStudio 6 thermocycler or an Applied Biosystems StepOnePlus system ...
-
BRD2 inhibition blocks SARS-CoV-2 infection by reducing transcription of the host cell receptor ACE2bioRxiv - Cell Biology 2021Quote: ... were amplified in a final volume of 5 μL per reaction in 384-well plates using the Luna Universal Probe One-Step RT-qPCR Kit (New England Biolabs) on a QuantStudio 6 Flex thermocycler ...
-
bioRxiv - Cancer Biology 2020Quote: ... and gKAT7 (A10) was purchased from IDT and cloned into the BsrGI site of pKLV-EF1aGFP using a NEBuilder HiFi kit (NEB), resulting in pKLV-EF1aGFP2AKAT7-W ...
-
bioRxiv - Cancer Biology 2020Quote: ... Libraries were generated using a NEBNext Ultra II DNA Library Prep Kit for Illumina (New England Biolabs, Cat No. E7645), including fragmentation with a Covaris S220 sonic disruptor ...
-
bioRxiv - Cell Biology 2021Quote: ... Libraries were then prepared from 500 ng genomic DNA using the NEBNext Ultra II FS DNA library prep kit for Illumina (New England Biolabs), according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2020Quote: ... C-terminal Myc tag of the biosensor and GFP were carried out with Q5 Site-Directed Mutagenesis Kit (New England Biolabs). The plasmid encoding this engineered periplasmic acetylcholine-binding protein (sequence MHHHHHHGGAQPARSANDTVVVGSIIFTEGIIVANMVAEMIEAHTDLKVVRKLNLGGV NVNFEAIKRGGANNGIDIYVEYTGHGLVDILGFPATTDPEGAYETVKKEYKRKWNIVWL KPLGFNNTYTLTVKDELAKQYNLKTFSDLAKISDKLILGATMFFLEGPDGYPGLQKLYN FKFKHTKSMDMGIRYTAIDNNEVQVIDAWATDGLLVSHKLKILEDDKAFFPPYYAAPIIR QDVLDKHPELKDVLNKLANQISLEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLILQVD ...
-
bioRxiv - Plant Biology 2021Quote: ... The resulting fragments were gel-purified with the QIAquick Gel Extraction Kit and ligated using T4 DNA Ligase (New England Biolabs) into dephosphorylated pBlueScript KS+ ...
-
bioRxiv - Plant Biology 2021Quote: ... IPT3 promoter DNA sequence was extracted and purified from the gel using Monarch DNA Gel Extraction Kit (New England Biolabs) and Sanger sequenced at Genewiz (South Plainfield ...
-
bioRxiv - Plant Biology 2021Quote: ... Quantitative reverse transcription-polymerase chain reaction (qRT-PCR) analyses were performed using Luna Universal Probe One-Step qRT-PCR Kit (New England Biolabs) following the manufacturer’s instructions ...
-
bioRxiv - Biochemistry 2021Quote: ... About 10ng of the purified CUT&RUN DNA was used for preparation of multiplexed libraries with the NEB Ultra II DNA Library Prep Kit per manufacturer’s instruction (NEB #E7103). Sequencing was conducted using an Illumina NextSeq 500 Sequencing System (available from the core facility of UNC Pharmacology Department).
-
bioRxiv - Biochemistry 2021Quote: ... 5’-TAATCAGACAAGGAACTGATTA-3’ (Forward) and 5’-CGAAGGTGTGACTTCCATG-3’ (Reverse) were used with the Luna Universal One-Step RT-qPCR Kit (New England Biolabs) in an Applied Biosystems QuantStudio 6 thermocycler ...
-
bioRxiv - Biochemistry 2021Quote: ... The LAMP reaction in the 2-step LAMP-CRISPR detection was performed using the WarmStart® LAMP Kit (NEB #E1700), using primer concentration described in literature (“Rapid Detection of SARS-CoV-2 Using Reverse transcription RT-LAMP method,” 2020) ...
-
Insights into the secondary structural ensembles of the full SARS-CoV-2 RNA genome in infected cellsbioRxiv - Biochemistry 2021Quote: Frameshifting reporter as well as positive and negative control mRNAs were in vitro transcribed and polyadenylated using HiScribe T7 mRNA kit (New England Biolabs) according to the manufacturers’ instructions ...
-
bioRxiv - Biochemistry 2020Quote: ... Genomic RNA fragments (Table S1) were synthesized following the protocol of HiScribe T7 high yield RNA synthesis kit (NEB, E2040S) with 1 μg purified PCR products ...
-
bioRxiv - Bioengineering 2021Quote: ... RNA was purified using the Macherey Nagel RNA extraction kit following manufacturer’s instruction and viral RNA uptake was quantified using the Luna universal One-Step RT-qPCR kit (NEB; E3005).
-
bioRxiv - Cell Biology 2021Quote: ... Single guide RNAs (sgRNAs) were synthesized using the EnGen sgRNA Synthesis Kit (for the Streptococcus pyogenes-originated Cas9, New England Biolabs). The SpCas9-sgRNA ribonucleoprotein (RNP ...
-
bioRxiv - Microbiology 2020Quote: ... Sequencing libraries were constructed with the NEBNext® Ultra™ II DNA Library Prep kit (New England Biolabs, MA, USA), and sequenced by Illumina-MiSeq at the Pittsburgh Bacteriophage Institute to an approximate shotgun coverage of 3538x ...
-
bioRxiv - Plant Biology 2020Quote: ... Size-selected DNA fragments were used to prepare eight MNase sequencing libraries with the NEBNext Ultra DNA Library Prep Kit for Illumina (NEB), following manufacturer’s instructions (2 biological replicates x 2 MNase concentrations x 2 tissues) ...
-
bioRxiv - Plant Biology 2020Quote: Sequencing libraries were generated from poly(A)-enriched RNA using the NEBNext Ultra II Directional RNA Library Prep kit (New England Biolabs) according to the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2020Quote: ... Equal amounts of RNA (~50 ng) were used for preparation of cDNA libraries with the NEBNext Multiplex Small RNA Library Prep kit for Illumina (NEB) with some minor changes to the manufacturers’ instructions ...
-
bioRxiv - Systems Biology 2021Quote: ... using the NEBNext Poly(A) mRNA Magnetic Isolation Module and NEBNext Ultra II Directional RNA Library Prep Kit for Illumina (New England Biolabs (NEB), Ipswich ...
-
bioRxiv - Microbiology 2020Quote: ... these long gene sequences containing enzyme sites firstly was amplified by common PCR by Q5 high-fidelity PCR kit (Cat: #M0491, NEB), using primer F and R pairs of S or N ...
-
bioRxiv - Systems Biology 2020Quote: ... Library preparation was performed using the NEBNext®Ultra™ II DNA Library Prep Kit for Illumina (New England Biolabs), and library quantification was performed using the KAPA library quantification kit (Kapa Biosystems) ...
-
bioRxiv - Systems Biology 2020Quote: The extracted plasmids were amplified using “lib-seq” primers in the Supplementary Table 6 for 10 cycles using Phusion PCR kit (NEB). Each 50 μL PCR reaction consisted of 6 μL of plasmid library ...
-
bioRxiv - Systems Biology 2020Quote: ... We neutralized the tagmentation activity of Enzyme 1 by immediately cleaning the reaction with the Monarch PCR & DNA Cleanup Kit (NEB) according to the manufacturer’s protocol ...
-
bioRxiv - Systems Biology 2020Quote: RNA-seq libraries were prepared using 200 ng of total RNA and the NEBNext rRNA Depletion Kit (NEB, Cat: E6310X), per manufacturer’s instructions ...
-
bioRxiv - Microbiology 2020Quote: Viral RNA genome for both WT ZIKV and the X1 mutant was in vitro transcribed from ligated plasmid DNA using a HiScribe T7 ARCA mRNA kit (NEB). Approximately 40 μg of the resulting mRNAs were transfected into Vero cells using MessengerMAX lipofectamine transfection reagent (Invitrogen) ...
-
bioRxiv - Plant Biology 2021Quote: ... and the purified mRNA was used to build sequencing libraries using the Ultra II Directional RNA library Prep Kit for Illumina (NEB). Single end sequencing of 76 bp were performed on NextSeq instrument (Illumina) ...