Labshake search
Citations for Millipore Sigma :
501 - 550 of 2188 citations for African Swine Fever Virus P30 E. coli since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: ... coli cells (69450; Sigma-Aldrich). Cells were grown at 37°C to an OD600 of 0.6–0.8 ...
-
bioRxiv - Biophysics 2023Quote: ... coli BL21 cells (Sigma-Aldrich) were transformed with the pCPLib_BL21 vector library via electroporation ...
-
bioRxiv - Pathology 2023Quote: ... coli O55:B5 (Sigma L6529), or 5 ng/mL of recombinant murine interleukin (IL ...
-
bioRxiv - Molecular Biology 2023Quote: ... coli Rosetta cells (Sigma-Aldrich). Protein expression was induced with 0.5 mM IPTG at 16°C overnight ...
-
bioRxiv - Biochemistry 2023Quote: ... coli BL21(DE3) pLysS (Novagen). The cells were grown at 37 °C with 250 rpm orbital shaking in Luria-Bertani broth supplemented with 100 μg/ml ampicillin until the OD600 reached 0.55-0.6 ...
-
bioRxiv - Genetics 2023Quote: ... coli cells (Novagen 69388-3) at 37°C for 3 hours using the bacterial expression plasmid pET-28b-FOXA1 ...
-
bioRxiv - Cell Biology 2023Quote: ... coli Rosetta2 pLysS (EMD Millipore), and the transformants were obtained on the nutrient agar plates containing carbenicillin and chloramphenicol antibiotics ...
-
bioRxiv - Cell Biology 2023Quote: ... coli was from Sigma-Aldrich. The NMDA-R inhibitors ...
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional removable N-terminal His6-Smt-tag (MGHHHHHHGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPL RRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG) ...
-
bioRxiv - Biophysics 2023Quote: ... coli Rosetta (DE3) cells (Novagen) and plated on LB-agar containing 50 μg/mL KAN and 25 μg/mL CAM ...
-
bioRxiv - Cell Biology 2023Quote: ... coli strain Rossetta2-pLysS (Novagen).
-
bioRxiv - Immunology 2024Quote: ... coli lipopolysaccharide (LPS, Sigma Aldrich) for final polarization to M1 or 2 ...
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional N-terminal MBP-and C-terminal His6-tag (MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA YPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWP LIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIA EAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGI NAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAAS EFSSNNNNNNNNNNLGIEGRMATLEKLMKAFESLKSFQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQP PPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPSGSHHHHHH) ...
-
bioRxiv - Biochemistry 2023Quote: ... coli BL21(DE3)pLysS (Novagen). The GST fusion LytMcat protein was produced the same way as LSScatGB1 ...
-
bioRxiv - Microbiology 2023Quote: ... coli BLR (DE3) cells (Novagen). Protein expression and purification was conducted as described for SasG-I lectin domain 16 ...
-
bioRxiv - Microbiology 2023Quote: ... coli expression vector (Merck-Novagen) using Gibson assembly ...
-
bioRxiv - Microbiology 2024Quote: ... coli strain Rosetta (DE3) (Novagen) was used for heterologous protein overexpression ...
-
bioRxiv - Molecular Biology 2024Quote: ... coli Rosetta2 pLysS (EMD Millipore) by growing cells in 2XYT media at 37°C to an OD600 of 0.55-0.75 ...
-
bioRxiv - Immunology 2024Quote: ... coli strain B (Sigma, D4889). To knockdown NFKB1 and p65 ...
-
bioRxiv - Biochemistry 2024Quote: ... coli Rosetta2 (DE3) cells (Novagen) were transformed with the plasmid and selected on an LB agar plate supplemented with 50 μg/ml kanamycin ...
-
bioRxiv - Biophysics 2024Quote: ... coli BL21 (DE3) cells (Novagen). The transformed bacteria were grown in 750 mL of LB medium at 37 ºC until reaching an optical density at a wavelength of 600 nm (OD600nm) ...
-
bioRxiv - Biochemistry 2023Quote: ... coli competent cells (Novagen, USA) pre-transformed with the pET15b-His-TDP-43 plasmid were induced for 4 h with 1mM isopropyl-β-D-1-thiogalactopyranoside (IPTG ...
-
bioRxiv - Cell Biology 2020Quote: ... Monoclonal rat E-cadherin antibody that specifically binds to the extracellular domain of E-cadherin (Sigma, U3254) was used at 1:1600 dilution ...
-
bioRxiv - Biochemistry 2021Quote: ... lysates of African green monkey COS-7 cells (Cell Lines Service, Eppelheim, Germany) and human HEK293T cells (ECACC via Sigma-Aldrich, Poznan, Poland) were analyzed by western blotting ...
-
bioRxiv - Molecular Biology 2022Quote: ... For each 10 cm dish, 1 ml virus inoculum was prepared in virus growth media (VGM; containing DMEM, 0.2% bovine serum albumin (Sigma; Cat no. #A8412), 25 mM N-(2-hydroxyethyl ...
-
bioRxiv - Microbiology 2020Quote: ... Aggregated virus was removed by a 0.22µm filter (Millipore). Sub-confluent monolayer of MEFs cultured in DMEM ...
-
bioRxiv - Physiology 2020Quote: ... Virus was filtered with a 0.45mm OVDF filter (Millipore). Supernatants were collected and purified using PEG-it (System Biosciences) ...
-
bioRxiv - Immunology 2020Quote: ... supernatant containing virus was filtered with 0.22μm filters (Millipore) and store at −80◻ in aliquots.
-
bioRxiv - Cancer Biology 2023Quote: ... adherent cells were infected with COL7A1 virus (Sigma Aldrich) (1–5 MOI (multiplicity of infection) ...
-
bioRxiv - Molecular Biology 2023Quote: ... and the virus was concentrated using polyethylglycol (Sigma, P4338). Cells were infected in medium containing 5 μg ml−1 polybrene (Millipore ...
-
bioRxiv - Microbiology 2022Quote: ... African green monkey kidney Vero’76 and human lung adenocarcinoma Calu-3 cells were maintained in DMEM (Sigma-Aldrich, D5796; St. Louis, MO, USA) supplemented with 10% fetal bovine serum (ThermoFisher ...
-
bioRxiv - Cancer Biology 2021Quote: ... 10 ng/ml EGF (Sigma, E 4127) and 100 μl LIF(Millipore ...
-
bioRxiv - Biochemistry 2020Quote: Anti-Japanese encephalitis E (mouse monoclonal, Millipore), influenza A H9N2 HA (mouse monoclonal ...
-
bioRxiv - Molecular Biology 2020Quote: Gamma secretase inhibitor Compound E (Millipore Sigma) was dissolved in DMSO and diluted 1:1000 in RPMI media to a final concentration of 1 μM ...
-
bioRxiv - Systems Biology 2021Quote: ... 10 μM E-64 (Sigma-Aldrich # 324890), 1.45 μM pepstatin (Sigma-Aldrich # P5318) ...
-
bioRxiv - Microbiology 2020Quote: ... The cathepsin inhibitor E-64d (Sigma-Aldrich), the serine protease inhibitor camostat mesylate (Abcam) ...
-
Kinetochore- and chromosome-driven transition of microtubules into bundles promotes spindle assemblybioRxiv - Cell Biology 2022Quote: ... Rabbit anti-CENP-E (C7488, Sigma Aldrich), diluted 1:100 ...
-
bioRxiv - Biochemistry 2021Quote: ... Ergosterol obtained from Sigma-Aldrich (E-6625), cholesterol ester ...
-
bioRxiv - Developmental Biology 2019Quote: ... 1.5 mg/mL ProNase E (Sigma P6911), 62.5 U/mL DNAse (Applichem ...
-
bioRxiv - Biochemistry 2020Quote: ... pepstatin and E-64 (Sigma Aldrich, USA). Then ...
-
bioRxiv - Bioengineering 2020Quote: ... Culture medium was Williams’ Media E (Sigma) supplemented with nicotinamide (12 mmol/L) ...
-
bioRxiv - Developmental Biology 2022Quote: ... 1x β-mercaptoethanol (Millipore, ES-007-E), 1µM PD98059 (Promega ...
-
bioRxiv - Cell Biology 2022Quote: ... and 10 μM E-64 (Sigma, E3132) for protease inhibition ...
-
bioRxiv - Cancer Biology 2023Quote: ... 3.6 μg/ml E-64 (Sigma-Aldrich), 5 mM EDTA (Calbiochem) ...
-
bioRxiv - Molecular Biology 2023Quote: ... 20-hydroxyecdysone (20-E) (H5142; Sigma Aldrich) was resuspended to an initial stock concentration of 10 mM in ethanol.
-
bioRxiv - Immunology 2024Quote: ... and stained with H&E (Sigma-Aldrich).
-
bioRxiv - Developmental Biology 2023Quote: ... and 3.4 mM vitamin E (Sigma-Aldrich) (45) ...
-
iDePP: a genetically encoded system for the inducible depletion of PI(4,5)P2 in Arabidopsis thalianabioRxiv - Plant Biology 2020Quote: ... coli (Novagen and Supplementary file 5) were transformed with pMH-HS-Sumo-dOCRL168-509 vector (KanR ...
-
bioRxiv - Microbiology 2021Quote: ... coli strain Rosetta2 (DE3) pLysS (Novagen). For each purification procedure ...
-
bioRxiv - Biophysics 2021Quote: ... coli Rosetta2 (DE3) pLysS cells (Novagen) were transformed with pET-21a plasmids encoding for PFD1 ...