Labshake search
Citations for Millipore Sigma :
3201 - 3250 of 10000+ citations for Urotensin 2 Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2023Quote: ... 2 mM EDTA (Sigma Aldrich)) with FcR blocking (Miltenyi Biotec ...
-
bioRxiv - Microbiology 2023Quote: ... 2% BSA (Sigma-Aldrich #A3059) solution for 30 min at RT before overnight incubation with primary antibodies in the same buffer at 4°C ...
-
bioRxiv - Neuroscience 2023Quote: ... 2 μM PD0332991 (Sigma-Aldrich) was added to remove proliferating cells ...
-
bioRxiv - Cell Biology 2023Quote: ... 2 µM FCCP (Sigma, C2920), 54 µM liproxstatin-1(Sigma ...
-
bioRxiv - Immunology 2023Quote: ... 24 µM 2-mercaptoethanol (Sigma), and 1% penicillin-streptomycin (Invitrogen) ...
-
bioRxiv - Cancer Biology 2023Quote: ... 2 μM thapsigargin (Sigma, T9033); T = 200 sec ...
-
bioRxiv - Microbiology 2023Quote: ... 2 mM ferrozine (Sigma-Aldrich), and 55 mM mannitol ...
-
bioRxiv - Microbiology 2023Quote: ... coli strain Rossetta-2 (Novagen), grown in LB containing 34 μg/ml chloramphenicol and 25 μg/ml kanamycin ...
-
bioRxiv - Biochemistry 2022Quote: ... and Pitstop-2 (Sigma: SML1169) were dissolved in DMSO to a final stock concentration of 50 mM ...
-
bioRxiv - Neuroscience 2023Quote: ... and 2 CaCl2 (Sigma #21115) in water bath (Thermo Scientific #2842 ...
-
bioRxiv - Immunology 2023Quote: ... 2% human serum (Sigma-Aldrich), 1% non-essential amino acids (ThermoFisher) ...
-
bioRxiv - Genomics 2023Quote: ... 0.1 mM 2-mercaptoethanol (Sigma), 5 ng/mL murine LIF (GlobalStem) ...
-
bioRxiv - Neuroscience 2023Quote: ... 2 μM forskolin (FSK; Sigma) and antibiotics (P/S/A ...
-
bioRxiv - Neuroscience 2023Quote: ... 2 μM SAG (Sigma, SML1314) and 1.5 μM CHIR99021 (Axon ...
-
bioRxiv - Cell Biology 2023Quote: ... shZNF598#2 (Sigma, Cat. # TRCN0000073162), shZNF598#3 (Sigma ...
-
bioRxiv - Microbiology 2024Quote: ... 2% L-glutamine (Sigma, Aldrich), and 2% antibiotic/antimycotic (Gibco by Life Technologies ...
-
bioRxiv - Cancer Biology 2024Quote: ... 2% FBS (Sigma-Aldrich F1051), 2% Chemically Defined Lipids (Thermo Scientific 11905031 ...
-
bioRxiv - Neuroscience 2023Quote: ... and forskolin (2 μM, Sigma). Media was changed every 2 days and mitogens were withdrawn 2 days prior to harvesting these cells for scRNA-seq.
-
bioRxiv - Molecular Biology 2024Quote: ... and 2 nM triiodothyronine (Sigma) [differentiation medium] for three days to reach full confluency ...
-
bioRxiv - Pharmacology and Toxicology 2024Quote: ... 2 mM L-glutamine (Sigma) and 1 mM sodium pyruvate (Sigma) ...
-
bioRxiv - Immunology 2023Quote: ... 0.1 mM 2-mercaptoethanol (Sigma). Where indicated ...
-
bioRxiv - Molecular Biology 2023Quote: 2-Mercaptoethanol (Sigma Aldrich #M6250).
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional removable N-terminal His6-Smt-tag (MGHHHHHHGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPL RRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG) ...
-
bioRxiv - Biochemistry 2023Quote: ... 2 mM MgCl2 (Sigma-Aldrich), 10 mM NaCl (Merck) ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 2-ME (Sigma-Aldrich). For in vitro analysis ...
-
bioRxiv - Genomics 2023Quote: ... 2 IU/mL heparin (Sigma), 5% human AB plasma (obtained from Bloodworks Northwest ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 2 (Sigma; Cat# P0044), and 1× phenylmethanesulfonyl fluoride (Sigma ...
-
bioRxiv - Immunology 2023Quote: ... 2% normal mouse serum (Sigma), 10% normal donkey or goat serum ...
-
bioRxiv - Immunology 2023Quote: ... and 50uM 2-mercaptoethanol (Sigma). RPMI-2 contained RPMI and was supplemented with bovine calf serum (2% ...
-
bioRxiv - Molecular Biology 2023Quote: ... and 2 mM glutamine (Sigma), with 2 μg/mL doxycycline (Dox ...
-
bioRxiv - Immunology 2023Quote: ... 100 nM 2-APB (Sigma), 10 μM BTP2 (Merk Millipore) ...
-
bioRxiv - Microbiology 2023Quote: 2-Deoxyglucose (2DG) (Sigma #D8375) was solubilized fresh for each experiment in cell culture medium to 100 mM and added to the culture medium at a final concentration of 10 mM ...
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional N-terminal MBP-and C-terminal His6-tag (MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA YPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWP LIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIA EAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGI NAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAAS EFSSNNNNNNNNNNLGIEGRMATLEKLMKAFESLKSFQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQP PPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPSGSHHHHHH) ...
-
bioRxiv - Biochemistry 2023Quote: ... and 2% donkey serum (Sigma) in PBS ...
-
bioRxiv - Microbiology 2023Quote: ... ActD: 2 µg/ml (Sigma), Shield1 ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 0.001% 2-mercaptoethanol (Sigma) and used immediately for co-culture assays ...
-
bioRxiv - Neuroscience 2023Quote: ... 2 mM EDTA (Sigma-Aldrich) and 10 µg/mL insulin (Sigma-Aldrich) ...
-
bioRxiv - Physiology 2023Quote: ... and 2% FBS (Millipore Sigma). The suspension was incubated in a 37°C water bath in a 15 ml conical for 25 minutes with aggressive trituration by glass Pasteur pipette every 8 minutes ...
-
bioRxiv - Plant Biology 2024Quote: ... 2% protease inhibitors (Sigma, P9599) were added in extraction buffer ...
-
bioRxiv - Microbiology 2023Quote: ... 55 µM 2-mercaptoethanol (Sigma), and 10 µg/mL gentamicin sulfate (Sigma ...
-
bioRxiv - Neuroscience 2023Quote: Risperidone (Sigma, 106266-06-2) dissolved in saline (lactated ringer ...
-
bioRxiv - Evolutionary Biology 2024Quote: ... and 2% glucose (Sigma-Aldrich) for 24-48 hr at 30 °C ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 mM glutamine (Sigma-Aldrich) and 100 µM non-essential amino acids (Thermo-Fisher ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 mM malate (M1000, Sigma), and 5 mM NaCl (S9888 ...
-
bioRxiv - Microbiology 2024Quote: ... 2 mM L-glutamine (Sigma), 15 mM HEPES (Sigma) ...
-
bioRxiv - Immunology 2024Quote: ... 50µM 2-mercaptoethanol (Sigma Aldrich), 100U/ml penicillin and 100µg/ml streptomycin ...
-
bioRxiv - Physiology 2024Quote: ... 2 nM T3 (Sigma-Aldrich) and 10 μg/ml transferrin (Sigma-Aldrich) ...
-
bioRxiv - Systems Biology 2024Quote: ... 2 mM EDTA (Sigma-Aldrich), and 1.2% Triton X-100 (Sigma-Aldrich) ...
-
bioRxiv - Cell Biology 2024Quote: ... 10 µM 2-mercaptoethanol (Sigma), and penicillin (100 units/mL)-streptomycin (100 µg/mL ...
-
bioRxiv - Cancer Biology 2024Quote: ... 50mmol/L 2-mercaptoethanol (Sigma) with 2mmol/L L-glutamine (ThermoFisher ...