Labshake search
Citations for Millipore Sigma :
2301 - 2350 of 10000+ citations for 7 Chloro N 3 chloro 4 fluorophenyl 6 nitro 4 quinazolinamine since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Physiology 2019Quote: ... Exendin-4 was purchased from Sigma-Aldrich. Labelled exendin-9 (DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC(Cy3)-NH2 ...
-
bioRxiv - Physiology 2019Quote: ... alone or with exendin-4 (Sigma-Aldrich) added at the indicated concentrations ...
-
bioRxiv - Cancer Biology 2019Quote: ... then coverslipped with Mowiol 4-88 (Sigma).
-
bioRxiv - Cancer Biology 2020Quote: ... Propidium iodide (Sigma-Aldrich, 25535-16-4), FITC Annexin V Apoptosis Detection Kit (BD Biosciences) ...
-
bioRxiv - Bioengineering 2021Quote: Cells were fixed with 4% formaldehyde (Sigma) for 15 min at room temperature ...
-
bioRxiv - Cancer Biology 2019Quote: ... then coverslipped with Mowiol 4-88 (Sigma). Slides were scanned using a Zeiss Axio Slide Scanner and images were analyzed using HALO software (Indica Labs).
-
bioRxiv - Immunology 2020Quote: ... and Polybrene (4 μg/ml; Merck Millipore) in a total volume of 7 ml (2 ml of a 15-min-preincubated transfection mix in serum-free DMEM added to 5 ml of fresh full DMEM) ...
-
bioRxiv - Developmental Biology 2020Quote: ... fixed in 4% paraformaldehyde (PFA) (Sigma #P6148) in PBS and processed for in situ hybridization ...
-
bioRxiv - Developmental Biology 2020Quote: ... fixed in 4% paraformaldehyde (PFA, Sigma P6148) in PBS overnight at 4°C at 4 dpf then stored in 100% MeOH at –20°C until processed for RNA in situ hybridization ...
-
bioRxiv - Microbiology 2021Quote: ... supplemented with 4 ug/mL polybrene (Sigma) for 6 hours ...
-
bioRxiv - Immunology 2020Quote: ... and 4 μg/mL DNase I (Sigma) in HBSS at 37°C for 1 h and 15 min with periodic vortex every 20 min ...
-
bioRxiv - Physiology 2019Quote: ... carbonyl cyanide 4-trifluoromethoxyphenylhydrazone (FCCP) (Sigma, C2920), in 0.05% ethanol E3 medium ...
-
bioRxiv - Cell Biology 2019Quote: ... cells were fixed in 4% paraformaldehyde (Sigma), washed by PBS and mounted by AntiFade mounting medium (containing 2 μg/mL DAPI ...
-
bioRxiv - Immunology 2019Quote: ... FITC-labeled dextran (Sigma-Aldrich, 4 kDa) was to the apical surface at a final concentration of 2 mg/mL ...
-
bioRxiv - Developmental Biology 2021Quote: Embryos were fixed in 4% PFA (Sigma) in PBS for 1.5 hours at 4°C and equilibrated in 30% sucrose (Fisher Scientific ...
-
bioRxiv - Physiology 2021Quote: ... [25μg/ml Bleomycin (Sigma # 9041-93-4), 5%DSS (Sigma ...
-
Myofiber injury induces capillary disruption and regeneration of disorganized microvascular networksbioRxiv - Physiology 2021Quote: ... and 4% normal goat serum (#50197Z, Sigma) in PBS ...
-
bioRxiv - Neuroscience 2021Quote: ... followed by 4% paraformaldehyde (P6148, Sigma Aldrich). The brain was extracted and post-fixed in 4% PFA for 24 hours ...
-
bioRxiv - Neuroscience 2020Quote: ... L-Valine (Sigma-Aldrich, 72-18-4), L-Cysteine (Sigma-Aldrich ...
-
bioRxiv - Neuroscience 2020Quote: ... L-Tyrosine (Sigma-Aldrich, 60-17-4), L-Threonine (Sigma-Aldrich ...
-
bioRxiv - Cell Biology 2021Quote: ... 4×104 monothioglycerol (MTG, Sigma-Al-drich), 50 µg/ml ascorbic acid (Sigma-Aldrich) ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... and 4% (w/v) sucrose (Sigma #S0389). Cells were then washed once with D-PBS for 10 min and permeabilized for 30 minutes with D-PBS containing 0,2% (v/v ...
-
bioRxiv - Developmental Biology 2020Quote: ... 4 mM Magnesium Chloride (Sigma-Aldrich, M1028) and 1 mM EGTA (Fisher Scientific ...
-
bioRxiv - Biophysics 2021Quote: ... 4 mM protocatechuic acid (PCA) (Sigma-Aldrich) and 100 nM protocatechuate 3,4-dioxygenase (PCD ...
-
bioRxiv - Cell Biology 2020Quote: ... 4-hydroxytamoxifen was purchased from Sigma (#H6278) and SAG was purchased from Abcam (#ab142160) ...
-
bioRxiv - Cell Biology 2020Quote: ... and Polybrene (4 μg/ml) (Sigma-Aldrich) and incubated overnight at 37°C ...
-
bioRxiv - Microbiology 2020Quote: ... Cells were fixed with 4% paraformaldehyde (Sigma), washed with PBS ...
-
bioRxiv - Neuroscience 2020Quote: ... followed by 4% paraformaldehyde (Sigma-Aldrich Inc) in 0.01 M PBS ...
-
bioRxiv - Microbiology 2021Quote: ... fixed in 4% paraformaldehyde/PBS (Sigma-Aldrich) for 15 min at room temperature ...
-
bioRxiv - Cell Biology 2021Quote: ... MOWIOL 4-88 (Calbiochem, Merck-Millipore, UK) mounting media was used in combination with 1 μg·mL-1 DAPI in PBS (Thermo Fisher Scientific ...
-
bioRxiv - Genetics 2019Quote: ... and 4 ug/ml laminin (Sigma-Aldrich). Cells were maintained in a 5% CO2 atmosphere at 37°C ...
-
bioRxiv - Immunology 2020Quote: ... and chromogenic substrate 4-nitrophenyl phosphate (Sigma). Purified monoclonal antibodies (B1-8μ and 18-1-16y1 ...
-
bioRxiv - Neuroscience 2022Quote: ... followed by 4% paraformaldehyde (PFA, Sigma, P6148) in PBS for 15 min.
-
bioRxiv - Developmental Biology 2022Quote: ... 4 mM Tubacin (Sigma Aldrich cat. #SML0065) dissolved in DMSO ...
-
bioRxiv - Developmental Biology 2022Quote: ... aggregates were fixed with 4% paraformaldehyde (Sigma) in PBS for 2 h at room temperature ...
-
bioRxiv - Biophysics 2022Quote: ... samples were fixed in 4% paraformaldehyde (Sigma) and blocked with 2% BSA Sigma) ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... cells were fixed with 4% paraformaldehyde (Sigma) in PBS for 10 min at room temperature ...
-
bioRxiv - Cell Biology 2022Quote: ... organoids were fixed with 4% formaldehyde (Sigma) at room temperature for 30 minutes ...
-
bioRxiv - Biophysics 2022Quote: ... 4 mM Hydroxyurea (Sigma; Cat. No. H8627) was added to the 60% to 80% confluent cultures for 48 h before harvesting ...
-
bioRxiv - Developmental Biology 2022Quote: ... and then fixed in 4% formaldehyde (Sigma) diluted in PBS for 10 mins before immunofluorescence staining ...
-
bioRxiv - Cell Biology 2022Quote: ... and 4 g/mL dispase II (Sigma) for 60 min at 37°C as previously described (Cui et al. ...
-
bioRxiv - Cell Biology 2022Quote: ... 5mM 4-OHT (Sigma-Aldrich Cat# H7904) were added to the medium and cells were cultured until the endpoint of talin deletion ...
-
bioRxiv - Genomics 2022Quote: ... and fixed in 4% paraformaldehyde (PFA, Sigma) for 40 minutes at room temperature (RT) ...
-
bioRxiv - Microbiology 2022Quote: ... by coupling with 4-niroaniline (pNA) (Sigma) as described in Nedev et al. ...
-
bioRxiv - Molecular Biology 2022Quote: ... with 4% (w/v) glucose (Sigma Aldrich) and 100 mM ß-mercaptoethylamine (MEA ...
-
bioRxiv - Microbiology 2022Quote: ... Cells were fixed with 4% formalin (Sigma) after two (MAYV) ...
-
bioRxiv - Molecular Biology 2023Quote: Antibodies: 4 μg COREST (Millipore, 07-455), 4 μg USP22 (Santa Cruz ...
-
bioRxiv - Neuroscience 2023Quote: ... 4 mM of L-glutamine (Sigma®), 100 units/mL penicillin and 100 μg/mL streptomycin at 37° C in 5% CO2 ...
-
bioRxiv - Cancer Biology 2024Quote: ... 4 mM sodium orthovanadate (Sigma-Aldrich, S6508) and 2X HALT protease and phosphatase inhibitor cocktail (Fisher Scientific ...
-
bioRxiv - Neuroscience 2022Quote: ... 4 µg/mL corticosterone (Sigma-Aldrich #C2505), 2.5 mg/mL insulin ...