Labshake search
Citations for Millipore Sigma :
751 - 800 of 4665 citations for SARS Coronavirus Spike Glycoprotein S1 Mosaic N Term E. coli since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: ... Escherichia coli DE3 cells (Novagen) were transformed with the pET28 plasmid and induced with 0.5 mM isopropyl β-D-1-thiogalactopyranoside (IPTG ...
-
bioRxiv - Synthetic Biology 2023Quote: ... coli BL21(DE3) Rosetta (Novagen) cells were used ...
-
bioRxiv - Biochemistry 2023Quote: ... coli Rosetta (DE3) cells (Novagen). Bacterial cultures were grown at 37 °C to OD600=0.7∼0.8 ...
-
bioRxiv - Cell Biology 2023Quote: ... coli cells (69450; Sigma-Aldrich). Cells were grown at 37°C to an OD600 of 0.6–0.8 ...
-
bioRxiv - Biophysics 2023Quote: ... coli BL21 cells (Sigma-Aldrich) were transformed with the pCPLib_BL21 vector library via electroporation ...
-
bioRxiv - Pathology 2023Quote: ... coli O55:B5 (Sigma L6529), or 5 ng/mL of recombinant murine interleukin (IL ...
-
bioRxiv - Molecular Biology 2023Quote: ... coli Rosetta cells (Sigma-Aldrich). Protein expression was induced with 0.5 mM IPTG at 16°C overnight ...
-
bioRxiv - Biochemistry 2023Quote: ... coli BL21(DE3) pLysS (Novagen). The cells were grown at 37 °C with 250 rpm orbital shaking in Luria-Bertani broth supplemented with 100 μg/ml ampicillin until the OD600 reached 0.55-0.6 ...
-
bioRxiv - Genetics 2023Quote: ... coli cells (Novagen 69388-3) at 37°C for 3 hours using the bacterial expression plasmid pET-28b-FOXA1 ...
-
bioRxiv - Cell Biology 2023Quote: ... coli Rosetta2 pLysS (EMD Millipore), and the transformants were obtained on the nutrient agar plates containing carbenicillin and chloramphenicol antibiotics ...
-
bioRxiv - Cell Biology 2023Quote: ... coli was from Sigma-Aldrich. The NMDA-R inhibitors ...
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional removable N-terminal His6-Smt-tag (MGHHHHHHGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPL RRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG) ...
-
bioRxiv - Biophysics 2023Quote: ... coli Rosetta (DE3) cells (Novagen) and plated on LB-agar containing 50 μg/mL KAN and 25 μg/mL CAM ...
-
bioRxiv - Cell Biology 2023Quote: ... coli strain Rossetta2-pLysS (Novagen).
-
bioRxiv - Immunology 2024Quote: ... coli lipopolysaccharide (LPS, Sigma Aldrich) for final polarization to M1 or 2 ...
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional N-terminal MBP-and C-terminal His6-tag (MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA YPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWP LIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIA EAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGI NAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAAS EFSSNNNNNNNNNNLGIEGRMATLEKLMKAFESLKSFQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQP PPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPSGSHHHHHH) ...
-
bioRxiv - Biochemistry 2023Quote: ... coli BL21(DE3)pLysS (Novagen). The GST fusion LytMcat protein was produced the same way as LSScatGB1 ...
-
bioRxiv - Microbiology 2023Quote: ... coli BLR (DE3) cells (Novagen). Protein expression and purification was conducted as described for SasG-I lectin domain 16 ...
-
bioRxiv - Microbiology 2023Quote: ... coli expression vector (Merck-Novagen) using Gibson assembly ...
-
bioRxiv - Microbiology 2024Quote: ... coli strain Rosetta (DE3) (Novagen) was used for heterologous protein overexpression ...
-
bioRxiv - Molecular Biology 2024Quote: ... coli Rosetta2 pLysS (EMD Millipore) by growing cells in 2XYT media at 37°C to an OD600 of 0.55-0.75 ...
-
bioRxiv - Immunology 2024Quote: ... coli strain B (Sigma, D4889). To knockdown NFKB1 and p65 ...
-
bioRxiv - Biochemistry 2024Quote: ... coli Rosetta2 (DE3) cells (Novagen) were transformed with the plasmid and selected on an LB agar plate supplemented with 50 μg/ml kanamycin ...
-
bioRxiv - Biophysics 2024Quote: ... coli BL21 (DE3) cells (Novagen). The transformed bacteria were grown in 750 mL of LB medium at 37 ºC until reaching an optical density at a wavelength of 600 nm (OD600nm) ...
-
bioRxiv - Biochemistry 2023Quote: ... coli competent cells (Novagen, USA) pre-transformed with the pET15b-His-TDP-43 plasmid were induced for 4 h with 1mM isopropyl-β-D-1-thiogalactopyranoside (IPTG ...
-
bioRxiv - Cell Biology 2020Quote: ... the wells were activated with N-(3-Dimethylaminopropyl)-N′-ethylcarbodiimide hydrochloride and N-Hydroxysuccinimide (both from Sigma-Aldrich) for 20 minutes ...
-
bioRxiv - Neuroscience 2022Quote: ... N-(3-aminopropyl)methacrylamide hydrochloride (APMA) and N,N′-bis(acryloyl)cystamine (BACA) were purchased from Sigma-Aldrich. Peptides ...
-
bioRxiv - Microbiology 2020Quote: ... Oligonucleotide primers were synthesized by Sigma-Aldrich (see Table S1 for sequences). Molecular biology procedures were carried out according to the manufactures’ instructions (New England Biolabs ...
-
bioRxiv - Physiology 2022Quote: ... 150 μl of 0.75mg/ml myelin oligodendrocyte glycoprotein 33 to 55 peptides (MOG35–55) mixed with Complete Freund’s Adjuvant (FS8810; Sigma-Aldrich) was injected subcutaneously into the tail base of 7 to 11-week-old female C57Bl/6 mice ...
-
bioRxiv - Molecular Biology 2021Quote: ... a sample containing 10 μg of the spike glycoprotein was buffer exchanged with 50 mM ammonium citrate buffer (pH 6.5) using a 50-kDa MWCO filter (Millipore). The resulting buffer-exchanged sample was alkylated with a 20-fold molar excess of 4-vinylpyridine in the dark for one hour at room temperature to cap free cysteine residues ...
-
bioRxiv - Neuroscience 2022Quote: ... Mice were immunized with 200 µg of myelin oligodendrocyte glycoprotein 35-55 (MOG35–55; MEVGWYRPFSRVVHLYRNGK) in incomplete Freund’s adjuvant (IFA; Sigma) supplemented with 8 mg/ml Mycobacterium tuberculosis H37Ra (Fisher) ...
-
bioRxiv - Neuroscience 2023Quote: ... Mice were immunized with 200 µg of myelin oligodendrocyte glycoprotein 35-55 (MOG35–55; MEVGWYRPFSRVVHLYRNGK) in incomplete Freund’s adjuvant (IFA; Sigma) supplemented with 8 mg/mL Mycobacterium tuberculosis H37Ra (Fisher) ...
-
bioRxiv - Cell Biology 2020Quote: ... Monoclonal rat E-cadherin antibody that specifically binds to the extracellular domain of E-cadherin (Sigma, U3254) was used at 1:1600 dilution ...
-
bioRxiv - Cell Biology 2020Quote: ... anti-P2X7 N-terminal 1:500 (cat. n. SAB2501287, Sigma-Aldrich); anti-P2X7 extracellular loop 1:200 (cat ...
-
bioRxiv - Biophysics 2020Quote: ... 1943 μl of N,N’- methylenebisacrylamide (BisAAm, Sigma #110-26-9) at 2% w/w in deionized water ...
-
bioRxiv - Bioengineering 2021Quote: ... and N,N-dimethylformamide (absolute >99.8%) were purchased from Sigma-Aldrich. N,N-diisopropylethylamine (DIPEA ...
-
bioRxiv - Bioengineering 2021Quote: ... with 50 mM (N-3-dimethylaminopropyl)-N’- ethylcarbodiimide hydrochloride (EDC; Sigma) and 100 mM N-hydroxysuccinimide sodium salt (NHS ...
-
bioRxiv - Microbiology 2021Quote: ... and derivatized with N-methyl-N-(trimethylsilyl)trifluoroacetamide (MSTFA) (Sigma-Aldrich) with 1% trimethylchlorosilane (TMCS ...
-
bioRxiv - Cancer Biology 2021Quote: ... 32.2 μl N-methyl-N-(trimethylsilyl)trifluoroacetamide (MSTFA; M7891, Sigma-Aldrich) and 2.8 μl Alkane Standard Mixture (50 mg/ml C10 – C40 ...
-
bioRxiv - Biophysics 2020Quote: ... 2.5 µL N,N’-methylenbisacrylamide (Sigma-Aldrich, M1533, 2% stock solution), and 5 µL 10X PBS ...
-
bioRxiv - Microbiology 2021Quote: ... 5-(N,N-Dimethyl)amiloride hydrochloride (100 μM, Sigma, cat #A4562) Acetazolamide (200 μM ...
-
bioRxiv - Molecular Biology 2021Quote: ... 0.15% (w/w) N,N’-methylenebisacrylamide (110-26-9, Sigma Aldrich)) was mixed ...
-
bioRxiv - Neuroscience 2019Quote: ... N--N-ethyl-2-bromobenzylamine (DSP4)14 (Sigma, 40616-75-9) ...
-
bioRxiv - Biochemistry 2021Quote: Dried N-glycans were hydrolyzed in 2 N TFA (Sigma Aldrich) at 100 °C for 2 h to release monosaccharides and cooled samples were again dried in a SpeedVac ...
-
bioRxiv - Cell Biology 2021Quote: ... 1 mM N-acetyl cysteine (N-Cys) (Sigma-Aldrich, A9165-5G), 10 µM Trolox (EMD Millipore ...
-
bioRxiv - Immunology 2021Quote: ... 500 mg of N-(3-dimethylaminopropyl)-N’-ethylcarbodiimide hydrochloride (Sigma-Aldrich) powder was added to the mixture ...
-
bioRxiv - Bioengineering 2022Quote: ... 1.335 g N,N-dimethylacrylamide (DMAA, #274135, Sigma-Aldrich now Merck) and 0.32 g sodium acrylate (SA ...
-
bioRxiv - Cell Biology 2022Quote: ... Mixes of PAA and bis-acrylamide (N,N′-methylenebisacrylamide, Sigma-Aldrich) corresponding to elasticity of 1 kPa and 40 kPa were prepared as described (Tse and Engler ...
-
bioRxiv - Molecular Biology 2023Quote: ... 2.5 μl of N,N’-methylenebisacrylamide (BIS, 2%, M1533, Sigma-Aldrich), and 5 μl of 10× PBS for 90 minutes at RT ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 100μL N-tert-Butyldimethylsilyl-N-methyltri fluoroacetamide (Sigma, MO, USA) for 90 min at 72°C ...