Labshake search
Citations for Millipore Sigma :
551 - 600 of 8488 citations for SARS Coronavirus Envelope Protein E. coli since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Pathology 2023Quote: ... coli O55:B5 (Sigma L6529), or 5 ng/mL of recombinant murine interleukin (IL ...
-
bioRxiv - Molecular Biology 2023Quote: ... coli Rosetta cells (Sigma-Aldrich). Protein expression was induced with 0.5 mM IPTG at 16°C overnight ...
-
bioRxiv - Biochemistry 2023Quote: ... coli BL21(DE3) pLysS (Novagen). The cells were grown at 37 °C with 250 rpm orbital shaking in Luria-Bertani broth supplemented with 100 μg/ml ampicillin until the OD600 reached 0.55-0.6 ...
-
bioRxiv - Genetics 2023Quote: ... coli cells (Novagen 69388-3) at 37°C for 3 hours using the bacterial expression plasmid pET-28b-FOXA1 ...
-
bioRxiv - Cell Biology 2023Quote: ... coli Rosetta2 pLysS (EMD Millipore), and the transformants were obtained on the nutrient agar plates containing carbenicillin and chloramphenicol antibiotics ...
-
bioRxiv - Cell Biology 2023Quote: ... coli was from Sigma-Aldrich. The NMDA-R inhibitors ...
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional removable N-terminal His6-Smt-tag (MGHHHHHHGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPL RRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG) ...
-
bioRxiv - Biophysics 2023Quote: ... coli Rosetta (DE3) cells (Novagen) and plated on LB-agar containing 50 μg/mL KAN and 25 μg/mL CAM ...
-
bioRxiv - Cell Biology 2023Quote: ... coli strain Rossetta2-pLysS (Novagen).
-
bioRxiv - Immunology 2024Quote: ... coli lipopolysaccharide (LPS, Sigma Aldrich) for final polarization to M1 or 2 ...
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional N-terminal MBP-and C-terminal His6-tag (MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA YPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWP LIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIA EAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGI NAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAAS EFSSNNNNNNNNNNLGIEGRMATLEKLMKAFESLKSFQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQP PPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPSGSHHHHHH) ...
-
bioRxiv - Biochemistry 2023Quote: ... coli BL21(DE3)pLysS (Novagen). The GST fusion LytMcat protein was produced the same way as LSScatGB1 ...
-
bioRxiv - Microbiology 2023Quote: ... coli BLR (DE3) cells (Novagen). Protein expression and purification was conducted as described for SasG-I lectin domain 16 ...
-
bioRxiv - Microbiology 2023Quote: ... coli expression vector (Merck-Novagen) using Gibson assembly ...
-
bioRxiv - Microbiology 2024Quote: ... coli strain Rosetta (DE3) (Novagen) was used for heterologous protein overexpression ...
-
bioRxiv - Molecular Biology 2024Quote: ... coli Rosetta2 pLysS (EMD Millipore) by growing cells in 2XYT media at 37°C to an OD600 of 0.55-0.75 ...
-
bioRxiv - Immunology 2024Quote: ... coli strain B (Sigma, D4889). To knockdown NFKB1 and p65 ...
-
bioRxiv - Biochemistry 2024Quote: ... coli Rosetta2 (DE3) cells (Novagen) were transformed with the plasmid and selected on an LB agar plate supplemented with 50 μg/ml kanamycin ...
-
bioRxiv - Biophysics 2024Quote: ... coli BL21 (DE3) cells (Novagen). The transformed bacteria were grown in 750 mL of LB medium at 37 ºC until reaching an optical density at a wavelength of 600 nm (OD600nm) ...
-
bioRxiv - Biochemistry 2023Quote: ... coli competent cells (Novagen, USA) pre-transformed with the pET15b-His-TDP-43 plasmid were induced for 4 h with 1mM isopropyl-β-D-1-thiogalactopyranoside (IPTG ...
-
bioRxiv - Cancer Biology 2021Quote: ... 5–10 μg of total protein per sample were subjected to 10-12% SDS-PAGE and transferred to Immobilon-E membranes (Millipore, #IEVH85R). The blots were developed using Pierce ECL Western Blotting Substrate (Thermo Scientific ...
-
bioRxiv - Developmental Biology 2022Quote: ... The dish was then incubated with 40 µg/mL mouse E-cadherin recombinant protein (8875-EC-050, Bio-Techne) or 40 µg/mL fibronectin (F1141, Sigma-Aldrich) at 4 □ overnight ...
-
bioRxiv - Biophysics 2022Quote: ... The E protein was cleaved from the EGFP-8xHis fusion by incubation of the beads with 150 units of thrombin (Sigma-Aldrich) overnight at 4 °C ...
-
bioRxiv - Cancer Biology 2022Quote: ... 5–10 μg of total protein per sample were subjected to 10-12% SDS-PAGE and transferred to Immobilon-E membranes (Millipore, #IEVH85R). The blots were developed using Pierce ECL Western Blotting Substrate (Thermo Scientific ...
-
bioRxiv - Cell Biology 2020Quote: ... The GST-His6-tagged forms of LC3B-His12 and GATE-16-His12 proteins were expressed in Escherichia coli BL21(DE3) cells (Novagen) harboring the pET-41-based vectors constructed in Lysogeny Broth (LB ...
-
bioRxiv - Epidemiology 2019Quote: ... and recombinant heat labile toxin β subunit protein [15,52,53] from enterotoxigenic Escherichia coli (ETEC LT β subunit) were purchased from Sigma Chemical (St ...
-
bioRxiv - Biophysics 2022Quote: ... the proteins were expressed in Escherichia coli strain BL21 Star (DE3) cells using 0.4 mM Isopropyl-β-D-thiogalactopyranoside (IPTG) (Sigma) for 9 to12 hours at 20 °C ...
-
bioRxiv - Microbiology 2020Quote: ... coli BL21 (DE3) (Transgen, CD601-02) and protein expression was induced by an auto-induction system (71757-5, EMD Millipore). Upon overnight induction at 25°C ...
-
bioRxiv - Plant Biology 2021Quote: The coding sequence of Hd3a and RFT1 were cloned into the pCold-GST vector42 and produced as a glutathione S-transferase (GST) fusion protein in Escherichia coli BL21 Rosetta (DE3) (Novagen). Cells were grown in LB medium or minimal medium containing 0.5 g l™1 of 15N-ammonium chloride ...
-
bioRxiv - Cell Biology 2019Quote: ... and His12-Arf1 proteins were expressed as the N-terminal GST-His6-tagged form in Escherichia coli BL21(DE3) cells (Novagen) harboring pET-41-based vectors in Lysogeny Broth (LB ...
-
bioRxiv - Physiology 2020Quote: ... tau/NTF or N-terminal (243-441) tau/CTF cDNA was used to produce recombinant tau protein in Escherichia coli BL21 (DE3) (Merck Millipore). Purification was performed as described previously (Hasegawa et al. ...
-
bioRxiv - Molecular Biology 2024Quote: Full length IMP2 protein was expressed as a pET-45 6-Histidine tagged 3C protease cleavable protein in Rosetta (DE3) pLysS Escherichia coli (Novagen) cells at 18 °C overnight ...
-
bioRxiv - Cell Biology 2020Quote: ... Monoclonal rat E-cadherin antibody that specifically binds to the extracellular domain of E-cadherin (Sigma, U3254) was used at 1:1600 dilution ...
-
bioRxiv - Cell Biology 2020Quote: ... Nuclear envelope breakdown was scored by observation of intact follicles cultured on organotypic membranes (Millipore, Cork IR) such that the prophase arrested nucleus (germinal vesicle ...
-
bioRxiv - Molecular Biology 2022Quote: ... Isotopically labelled proteins were expressed using Escherichia coli BL21 DE3 cells in M9 minimal media supplemented with 15NH4Cl (Sigma-Aldrich ISOTEC). Chaetomium thermophilum Naa5082-289 containing a C-terminal His-tag was expressed using E ...
-
bioRxiv - Molecular Biology 2019Quote: ... coli as a fusion protein with the ketosteroid isomerase (KSI) using the pET31 plasmid (Kuliopulos et al., 1994) (Novagen/EMD Biosciences). KSI fusion proteins are concentrated in inclusion bodies in E ...
-
bioRxiv - Cancer Biology 2021Quote: ... 10 ng/ml EGF (Sigma, E 4127) and 100 μl LIF(Millipore ...
-
bioRxiv - Biochemistry 2020Quote: Anti-Japanese encephalitis E (mouse monoclonal, Millipore), influenza A H9N2 HA (mouse monoclonal ...
-
bioRxiv - Molecular Biology 2020Quote: Gamma secretase inhibitor Compound E (Millipore Sigma) was dissolved in DMSO and diluted 1:1000 in RPMI media to a final concentration of 1 μM ...
-
bioRxiv - Systems Biology 2021Quote: ... 10 μM E-64 (Sigma-Aldrich # 324890), 1.45 μM pepstatin (Sigma-Aldrich # P5318) ...
-
bioRxiv - Microbiology 2020Quote: ... The cathepsin inhibitor E-64d (Sigma-Aldrich), the serine protease inhibitor camostat mesylate (Abcam) ...
-
Kinetochore- and chromosome-driven transition of microtubules into bundles promotes spindle assemblybioRxiv - Cell Biology 2022Quote: ... Rabbit anti-CENP-E (C7488, Sigma Aldrich), diluted 1:100 ...
-
bioRxiv - Biochemistry 2021Quote: ... Ergosterol obtained from Sigma-Aldrich (E-6625), cholesterol ester ...
-
bioRxiv - Developmental Biology 2019Quote: ... 1.5 mg/mL ProNase E (Sigma P6911), 62.5 U/mL DNAse (Applichem ...
-
bioRxiv - Biochemistry 2020Quote: ... pepstatin and E-64 (Sigma Aldrich, USA). Then ...
-
bioRxiv - Bioengineering 2020Quote: ... Culture medium was Williams’ Media E (Sigma) supplemented with nicotinamide (12 mmol/L) ...
-
bioRxiv - Developmental Biology 2022Quote: ... 1x β-mercaptoethanol (Millipore, ES-007-E), 1µM PD98059 (Promega ...
-
bioRxiv - Cell Biology 2022Quote: ... and 10 μM E-64 (Sigma, E3132) for protease inhibition ...
-
bioRxiv - Cancer Biology 2023Quote: ... 3.6 μg/ml E-64 (Sigma-Aldrich), 5 mM EDTA (Calbiochem) ...
-
bioRxiv - Molecular Biology 2023Quote: ... 20-hydroxyecdysone (20-E) (H5142; Sigma Aldrich) was resuspended to an initial stock concentration of 10 mM in ethanol.