Labshake search
Citations for Millipore Sigma :
5101 - 5150 of 10000+ citations for Creatinine Serum Kit 2 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2024Quote: ... 50 µM 2-ME (Sigma) and 30 ng/ml GM-CSF (Peprotech ...
-
bioRxiv - Cancer Biology 2024Quote: ... 2% Tween-20 (Sigma-Aldrich) and incubated for 1 h at 65°C followed by 15 min at 95°C ...
-
bioRxiv - Genomics 2024Quote: ... 2 mM VRC (Sigma-Aldrich), 0.2 mg/ml RNase-free bovine serum albumin (BSA ...
-
bioRxiv - Neuroscience 2024Quote: ... L-Glutamine (Sigma, 2 mM), HBEGF (5ng/mL) ...
-
bioRxiv - Neuroscience 2024Quote: ... and rotenone (2 μM, Sigma), an inhibitor of mitochondrial complex I ...
-
bioRxiv - Neuroscience 2024Quote: ... 2 mg/mL doxycycline (Sigma), and 2 μg/mL puromycin (Sigma) ...
-
bioRxiv - Microbiology 2024Quote: ... with 2% FBS (Sigma-Aldrich), 100U/ml penicillin ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 mM L-glutamine (Sigma), and 1% penicillin/streptomycin (Sigma) ...
-
bioRxiv - Neuroscience 2024Quote: ... oligomycin (2 μg/ml, Sigma), an inhibitor of ATP synthesis ...
-
bioRxiv - Molecular Biology 2024Quote: ... and 2 nM triiodothyronine (Sigma) [differentiation medium] for three days to reach full confluency ...
-
bioRxiv - Cancer Biology 2024Quote: ... or oligomycin (2 µM; Sigma) for 4 h before measurement ...
-
bioRxiv - Bioengineering 2023Quote: ... Holotransferrin (2 mg/ml, Sigma) was added to cells 24 hours after transfection ...
-
bioRxiv - Neuroscience 2023Quote: ... 2 mM EGTA (Sigma-Aldrich), 5 mM KCl (Fisher Scientific) ...
-
bioRxiv - Developmental Biology 2024Quote: ... 2 μM XAV939 (Sigma, X3004), and 20 ng/ml hLIF (Peprotech ...
-
bioRxiv - Cancer Biology 2023Quote: ... 2 µM FCCP (Sigma #C2920); Port C ...
-
bioRxiv - Cell Biology 2024Quote: ... and S3QEL 2 (SML1554, Sigma) were prepared in DMSO (BS-2245K ...
-
bioRxiv - Cell Biology 2024Quote: ... 2) Safranin-O (Sigma #S2255), 2.5 minutes ...
-
bioRxiv - Cell Biology 2024Quote: ... puromycin (SIGMA, 2 μg/mL) was added to target cells on D1 and maintained at a concentration of 1 μg/mL from D4 to D11.
-
bioRxiv - Developmental Biology 2024Quote: ... and 2 µM forskolin (Sigma). STBs were incubated at 37°C in 5% CO2 and 3% O2 ...
-
bioRxiv - Genetics 2024Quote: ... 2 µM Dorsomorphin (Sigma Aldrich) and 3 µM IWR1-endo (Millipore) ...
-
bioRxiv - Microbiology 2024Quote: ... 2-mercaptoethanol (Sigma Aldrich, USA). Next ...
-
bioRxiv - Genomics 2024Quote: ... 2 mM EDTA (Sigma, E7889) in PBS) ...
-
bioRxiv - Genomics 2024Quote: ... 2 mM EDTA (Sigma, E7889) in PBS) ...
-
bioRxiv - Genomics 2024Quote: ... 50uM 2-beta mercaptoethanol (Sigma), 10mM nicotinamide (SIGMA) ...
-
bioRxiv - Immunology 2024Quote: ... and 2 µM ionomycin (Sigma), 10 ng/mL recombinant IL-33 (Biolegend) ...
-
bioRxiv - Cancer Biology 2023Quote: ... 50 nM 2-mercaptoethanol (Sigma), 30 ng/ml EGF (Novoprotein) ...
-
bioRxiv - Bioengineering 2024Quote: ... NaOH (2 M, Sigma Aldrich) in a concentration 0.4 mmol gram-1 of gelatin ...
-
bioRxiv - Cancer Biology 2024Quote: ... supplemented with 2% FBS (Sigma) for 20 min at 4°C ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 μM Gö6983 (Sigma- Aldrich), and 10 ng/mL LIF ...
-
bioRxiv - Immunology 2023Quote: ... 100 nM 2-APB (Sigma), 10 μM BTP2 (Merk Millipore) ...
-
bioRxiv - Microbiology 2023Quote: ... ActD: 2 µg/ml (Sigma), Shield1 ...
-
bioRxiv - Neuroscience 2023Quote: ... 2 mM EDTA (Sigma-Aldrich) and 10 µg/mL insulin (Sigma-Aldrich) ...
-
bioRxiv - Neuroscience 2023Quote: Risperidone (Sigma, 106266-06-2) dissolved in saline (lactated ringer ...
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional N-terminal MBP-and C-terminal His6-tag (MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA YPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWP LIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIA EAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGI NAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAAS EFSSNNNNNNNNNNLGIEGRMATLEKLMKAFESLKSFQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQP PPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPSGSHHHHHH) ...
-
bioRxiv - Genetics 2022Quote: ... 2 IU/ml heparin (Sigma), 5% human AB serum (Eurobio AbCys) ...
-
bioRxiv - Developmental Biology 2023Quote: ... 2 and 3 (Sigma-Aldrich). The homogenate was sheared through a 26-gauge needle and sonicated three times for 20-second bursts ...
-
bioRxiv - Immunology 2023Quote: ... 50uM 2-mercaptoethanol (Sigma-Aldrich) and 1% penicillin/streptomycin (Sigma-Aldrich).
-
bioRxiv - Neuroscience 2023Quote: ... and collagenase type 2 (Sigma), then mechanical dissociated by trituration ...
-
bioRxiv - Microbiology 2023Quote: ... 2 mM MgSO4 (Sigma Aldrich), 0.1 mM CaCl2 (Sigma Aldrich) ...
-
bioRxiv - Developmental Biology 2022Quote: ... 2-mM L-glutamine (Sigma), and 5.0 mg/mL of Folltropin (Vetoquinol) ...
-
bioRxiv - Neuroscience 2023Quote: ... CaCl2 (2 mM, Sigma-Aldrich), NaH2PO4 (1.2 mM ...
-
bioRxiv - Neuroscience 2023Quote: ... MgCl2 (2 mM, Sigma-Aldrich); CaCl2 (2 mM ...
-
bioRxiv - Cancer Biology 2023Quote: ... Thapsigargin (Sigma; 0.1-2 μM), Tunicamycin (Sigma ...
-
bioRxiv - Plant Biology 2023Quote: ... coli BL21 Rosetta 2 (Novagen) were transformed with the pETDuet SEP375–178 /AG90–189 construct and grown either in LB or minimal medium containing selenomethionine as described49 ...
-
bioRxiv - Immunology 2023Quote: ... 2 nM PS341 (Sigma #504314), and 30 ng/ml mouse IFNβ (R&D Systems #8234-MB-010)
-
Neuron-astrocyte metabolic coupling facilitates spinal plasticity and maintenance of persistent painbioRxiv - Neuroscience 2022Quote: ... 2 mM DTT (Sigma, 10197777001), 100 U/ml RNasin (Promega ...
-
bioRxiv - Developmental Biology 2022Quote: ... 2 μM Forskolin (Sigma, F3917) and 4% KSR (Invitrogen ...
-
bioRxiv - Cancer Biology 2022Quote: ... and 2 (Sigma; Cat# P0044), and 1× phenylmethanesulfonyl fluoride (Sigma ...
-
bioRxiv - Genetics 2022Quote: ... 2 μL Flag (Sigma, F1804) or 1 μL WC-2 antibody (Cheng ...
-
bioRxiv - Microbiology 2023Quote: ... 2 mM MβCD (Sigma-Aldrich) or 40 mM Los (Sigma-Aldrich ...