Labshake search
Citations for Addgene :
351 - 400 of 542 citations for Rat N acylethanolamine hydrolyzing acid amidase NAAA ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: ... PH-FFAT/N-PH-FFAT sequences (5’-NheI/3’-AscI) were amplified by PCR from pLJM1-FLAG-GFP-OSBP plasmid (Addgene#134659). The sequences encoding Twitch (Twitch2b/Twitch7x/Twitch8x/Twitch9x ...
-
bioRxiv - Cancer Biology 2023Quote: ... mice were generated by subcloning an N-terminal 3x HA-tagged CIC-DUX4 fusion gene from Yoshimoto et al.6 into a Rosa26 targeting construct (Addgene #21714). The sequence verified construct was then transfected into ES cells and selected in G418 media ...
-
bioRxiv - Molecular Biology 2023Quote: pLEX-FLAG-Cre-GFP was generated by cloning PCR-amplified N-terminal FLAG tagged Cre-GFP (from pCAG-Cre-GFP; Addgene #13776) (Forward primer ...
-
bioRxiv - Neuroscience 2023Quote: ... PV-cre mice received unilateral injections in the left lobule simplex of 0.7 µl of pAAV-1-hSyn1-Flex-SIO-stGtACR2-FusionRed-dlox (N = 5, 2.0 × 1012 genome copies/mL; Addgene: 105677-AAV1), while another group of PV-cre mice received injections of pAAV-9/2-hSyn1-dlox-tdTomato-dlox-WPRE (N = 3 ...
-
bioRxiv - Molecular Biology 2024Quote: ... we cloned N-terminally StrepII-tagged JetA (C36A, C355A) and untagged JetB into UC Berkeley Macrolab vector 13S-A (Addgene # 48323). To generate truncated JetA constructs ...
-
bioRxiv - Cancer Biology 2024Quote: ... the NINJ1 cDNA from pENTR223-NINJ1 (DNASU, HsCD00505254) and SLC7A11 cDNA from pENTR223-SLC7A11 (DNASU, HsCD00512940) were individually subcloned into pLVpuro-CMV-N-EGFP (Addgene, #122848) and pLVpuro-CMV-N-mCherry (Addgene ...
-
bioRxiv - Microbiology 2024Quote: ... The new product replaced an existing gene when inserted into pcDNA3.1 containing a triple N-FLAG-tag between KpnI and EcoRI (Addgene plasmid #67788). The GFP transfection control plasmid ...
-
bioRxiv - Synthetic Biology 2023Quote: ... The YTK kit (Addgene; Kit #1000000061) was used as a source for all relevant non-coding DNA sequences — including promoters and terminators ...
-
bioRxiv - Microbiology 2024Quote: ... Plasmids expressing GST-tagged WT Dynamin 2 or Dynamin 2 ΔPRD were constructed using the Takara Biosciences In-Fusion system and a plasmid encoding rat WT Dynamin 2 (Addgene 34684) as a template ...
-
bioRxiv - Neuroscience 2024Quote: ... two 5 weeks old rats habituated to tickling underwent unilateral injection of 100 nl at 30 nl/min of AAV2/5.hsyn.eGFP (Addgene, 50465-AAV5) in the insular cortex at the following coordinates ...
-
bioRxiv - Physiology 2024Quote: ... Pparg1 or Pparg2 in NIH-3T3 cells was performed by transfecting pcDNA3.1(-) rat C/EBP alpha (#12550, Addgene, Watertown, MA, USA), pcDNA-mC/EBPb (#49198 ...
-
bioRxiv - Biophysics 2021Quote: ... we used the retinoic acid-responsive firefly luciferase expression vector pGL3-RARE-luciferase (Addgene plasmid #13458; http://n2t.net/ad-dgene:13458; RRID:Addgene_13458), a gift from T ...
-
bioRxiv - Physiology 2019Quote: HepG2 cells were transfected with the luciferase expression construct under the Fatty Acid Synthetase (FAS) Promoter (Addgene# 8890) along with β-Gal plasmid (Ambion Cat ...
-
bioRxiv - Cell Biology 2020Quote: ... or WIPI1 or WIPI2 cDNA were cloned with N-terminal EGFP or DsRed fusions in pCAG vector (a gift from Connie Cepko (Addgene plasmid #11150)) (Matsuda & Cepko ...
-
bioRxiv - Developmental Biology 2021Quote: ... The Dox inducible CRISPRi vector was created by sub-cloning N-terminal KRAB-dCas9 (a gift from Bruce Conklin, Addgene plasmid # 73498) into the NKX2-1 overexpressing vector using XhoI and BamHI sites ...
-
bioRxiv - Genomics 2021Quote: Human codon-optimized optimized Streptococcus pyogenes dCas9 with two C-terminal SV40 NLSs was fused at the N-terminus to the ABI domain (gift from Jerry Crabtree, Addgene plasmid #38247) and tagBFP ...
-
bioRxiv - Biochemistry 2021Quote: ... PLpro DNA was subcloned into the biGBac vector pLIB [29] to include an N-terminal 3xFlag-His6 tag (sequence: MDYKDHDGDYKDHDIDYKDDDDKGSHHHHHHSAVLQ) (Addgene ID 169194). Baculoviruses were generated using the EMBacY baculoviral genome [30] in Sf9 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Cell Biology 2021Quote: The plasmid containing the TRF2-ΔB-ΔM (deletion mutant lacking the N-terminal basic domain and C-terminal Myb domain) was obtained from Addgene (plasmid #2431), as previously described (Barinda et al. ...
-
bioRxiv - Genomics 2022Quote: ... BPTF BD with an N-terminal 6xHistidine (6His) tag and Tobacco Etch Virus (TEV) Protease cleavage site was from Addgene (plasmid 39111). This was modified using the Q5 Site-directed mutagenesis kit (New England Biolabs [NEB] ...
-
bioRxiv - Microbiology 2022Quote: ... full length 3CLpro coding-sequences with N-terminal 6His tags were synthesized by Integrated DNA Technologies (Coralville, IA) and cloned into pET-28a(+) vector (Addgene, Cambridge, MA). Subsequently ...
-
bioRxiv - Neuroscience 2020Quote: 8 weeks old Mrap2fl/fl Mc4regfp females (n=4) were injected unilaterally with pAAV-Ef1a-mCherry-IRES-CRE (Addgene, catalog #55632-AAV8).
-
bioRxiv - Cell Biology 2022Quote: N-terminal Venus fragment fused to full-length ORAI1 and C-terminal Venus fused to full-length STIM1 were cut out and amplified from plasmids pcDNA3-Venus-173-N-ORAI1 (a gift from Jin Zhang; Addgene plasmid #87618) and pcDNA3.1-STIM1-Venus-173-C (a gift from Jin Zhang ...
-
bioRxiv - Microbiology 2020Quote: ... ORF68 and its homologs were subcloned into the NotI and XhoI sites of pcDNA4/TO-2xStrep (N-terminal) using InFusion cloning (Clontech) (Addgene #x-x). Mutations in ORF68 (Addgene #x-x ...
-
bioRxiv - Molecular Biology 2019Quote: ... ORF66 aa 1-200 was cloned into the NotI and XhoI sites of pcDNA4/TO-2xStrep (N-terminal tag) to generate pcDNA4/TO-2xStrep-ORF66 1-200 (Addgene plasmid #130954) and ORF66 aa 200-429 was cloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag ...
-
bioRxiv - Genetics 2021Quote: RPA1 expression constructs were generated as derivatives of a RPA1-WT expression construct pLX304-hRPA1 bearing bearing an N-ter V5 tag (Addgene Plasmid #25890). The R41E ...
-
bioRxiv - Biochemistry 2021Quote: a codon optimised nagK gene from Plesiomonas shigelloides was cloned into the pOPINS3C expression plasmid (N-terminal polyhistidine and SUMO tags; Addgene #41115 (59)) ...
-
bioRxiv - Microbiology 2020Quote: ... carries the marker mutation A1244G and was cloned from the tdTomato-pBAD plasmid (a kind gift from Drs. M. Davidon, N. Shaner, and R. Tsien, Addgene plasmid #54856). The humanised reporter gene Renilla luciferase (GenBank AF362549 ...
-
bioRxiv - Cell Biology 2023Quote: ... polyspora Hop1319-529 into UC Berkeley Macrolab vectors to generate N-terminal TEV protease-cleavable His6- or His6-maltose binding protein tags (Addgene #29666, 29706). DNA binding mutants of S ...
-
bioRxiv - Microbiology 2023Quote: ... Two gRNA binding sites near the 3’ region of each gene of interest were identified using EuPaGDT Editing of the previously modified pTREX-n-Cas9 plasmid 51 (Addgene plasmid 68708), performed to exchange the previous gRNA sequence was achieved using a Q5 mutagenesis kit (New England Biolabs ...
-
bioRxiv - Biophysics 2023Quote: ... with an N-terminal hexahistidine tag and T7 tag in pRSET plasmid was gift from was a gift from Yasushi Saeki (Addgene plasmid # 110313)46 ...
-
The Hippo pathway terminal effector TAZ/WWTR1 mediates oxaliplatin sensitivity in colon cancer cellsbioRxiv - Cancer Biology 2023Quote: Murine Taz was expressed by transfecting cells with pEF-TAZ-N-Flag from Michael Yaffe (Addgene #19025; RRID:Addgene_19025; Kanai et al., 2000).
-
bioRxiv - Physiology 2023Quote: ... with the carboxy tail fused to either the N-fragment (VN) or the C-fragment (VC) of the Venus protein (27097, 22011; Addgene, Cambridge, MA), auxiliary subunits CaVα2δ ...
-
bioRxiv - Microbiology 2023Quote: ... 9 µg of a vector carrying either the CD13/aminopeptidase N sequence (pLEX307-APN-G418 was a gift from Alejandro Chavez & Sho Iketani; Addgene plasmid #158456) or the TMPRSS2 sequence (pLEX307-TMPRSS2-blast was a gift from Alejandro Chavez & Sho Iketani ...
-
bioRxiv - Bioengineering 2022Quote: ... which was constructed by fusing two nuclear localization signals to both of C- and N-terminal of pCMV-PE2-SpG (Addgene plasmid #159978), and pCMV-PEmax-SpG-P2A-hMLH1dn ...
-
bioRxiv - Cell Biology 2023Quote: ... a donor plasmid pAAVS1-TRE3G-NGN2 was generated by replacing the EGFP sequence with N-terminal flag-tagged human NGN2 cDNA sequence in plasmid pAAVS1-TRE3G-EGFP (Addgene plasmid # 52343). 5μg of pAAVS1-TRE3G-NGN2 ...
-
bioRxiv - Cell Biology 2023Quote: ... The fragments of bPAC and TGNP were amplified from cytoplasmic-bPAC (a gift from Dr. Reiter lab) and pmApple-TGNP-N-10 (Addgene plasmid #54954), respectively ...
-
bioRxiv - Biophysics 2023Quote: ... was expressed in E.coli using a gene with an N-terminal 6×His-tag and an upstream TEV-protease site cloned into pET28a(+) (Addgene plasmid #20061). MSP1D1 was purified using IMAC with further cleavage of 6×His-tag by TEV protease 50,51 ...
-
bioRxiv - Genetics 2023Quote: ... containing the sgRNA-EGxxFP reporter target sequence was placed between the N and C parts of the EGFP fragment of pCX-EGxxFP [25] (Addgene plasmid #50716). PGK>HSV-TK was then inserted downstream of the CAG>EGxxFP reporter ...
-
bioRxiv - Molecular Biology 2024Quote: The human MPST expression plasmid with the N-terminal His tag with TEV cleavage site (MPSTA) was a gift from Nicola Burgess-Brown (Addgene plasmid #42482). This construct was co-expressed with chaperones groEL ...
-
bioRxiv - Molecular Biology 2024Quote: The human MPST expression plasmid with the N-terminal His tag with TEV cleavage site (MPSTA) was a gift from Nicola Burgess-Brown (Addgene plasmid #42482). The N-terminal His tag construct of human MPST was co-transformed with GroES-EL chaperon plasmid from Takara (#3340) ...
-
bioRxiv - Synthetic Biology 2022Quote: ... MoClo Plant Parts Kit (Addgene Kit #1000000047), GreenGate Cloning System (Addgene Kit #1000000036 ...
-
bioRxiv - Neuroscience 2021Quote: ... CRF1:Cre-tdTomato rats were given bilateral microinjections of AAV8-hSyn-DIO-HA-hM3D(Gq)-IRES-mCitrine (50454-AAV8, Addgene, Watertown, MA) or a control virus (AAV5-hSyn-DIO-EGFP ...
-
bioRxiv - Neuroscience 2023Quote: ... and female (n=14) rats underwent aseptic stereotaxic surgery for injection of 150nl retrograde-transducing AAV carrying fluorophore mCherry (pAAV-hSyn-mCherry; Addgene; 114472-AAVrg)) into the BLA (AP -3.0 ...
-
bioRxiv - Molecular Biology 2019Quote: ... GFP-POLE3 full length and GFP-POLE3 with amino acid residues 113-140 deleted (GFP-POLE3ΔC) were cloned between NheI and AgeI restriction sites of pCW57.1 (Addgene: 41393),
-
bioRxiv - Biochemistry 2021Quote: ... DNA encoding amino acids Ala696-Phe740 of human DDX1 was cloned into UC Berkeley MacroLab 438C (Addgene plasmid #55220). The resulting plasmid encoded for untagged RTCB(1-505) ...
-
bioRxiv - Neuroscience 2021Quote: ... and SAD-B19 helper proteins (N, 52.11 mg, Addgene 59924; P, 30.15 mg, Addgene 59925; L, 23.70 mg, Addgene 59922; G, 20.26 mg, Addgene 59921). Cells were maintained with DMEM with GlutaMAX supplement ...
-
bioRxiv - Neuroscience 2020Quote: ... Plasmids coding for pHRIG-Akt1 (Akt-CA) and pHRIG-AktDN (Akt-N) were gifts from Heng Zhao (Addgene plasmids #53583 and 53597 respectively). MAP2-GFP was previously described (Liot et al. ...
-
bioRxiv - Developmental Biology 2021Quote: ... with the only exception of ΔR2 and ΔF_ALL_Inv that were generated by using a pair of sgRNA. The guide sequences (listed in Supp. Table 1) were then cloned in px459 CRISPR/Cas9 vector (Addgene Cat. N. 62988), previously digested with Bbs1 ...
-
bioRxiv - Systems Biology 2023Quote: ... mCherry-LC3 and mNeon tagged N-terminally with the lipidation sequence of Lck (LckLip-mNeon, the original plasmid was a gift from Dorus Gadella (Addgene plasmid # 98821, (40)) ...
-
bioRxiv - Synthetic Biology 2023Quote: ... The original bicone construct (A2C-∆ N) was prepared by deleting gvpN from the full GV gene cluster (available on Addgene as plasmid #106473) via KLD mutagenesis using enzymes from New England Biolabs and primers from IDT ...