Labshake search
Citations for Addgene :
401 - 450 of 1023 citations for Human AXL His tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Genomics 2024Quote: ... and the top two scoring sgRNAs for each target gene based on depletion or enrichment phenotypes were cloned into dual sgRNA lentivirus expression vectors with direct capture tags (Addgene 187241)40 using NEBuilder HiFi DNA Assembly Master Mix (New England Biolabs #E2621L ...
-
bioRxiv - Cell Biology 2024Quote: ... The DNA fragment of tight TRE promoter with ATG start codon and 3XFLAG tag was amplified from pCW-Cas9 (Addgene #50661). The DNA fragment of hPGK-PuroR-rTetR was amplified from pCW-Cas9 ...
-
bioRxiv - Microbiology 2024Quote: ... The new product replaced an existing gene when inserted into pcDNA3.1 containing a triple N-FLAG-tag between KpnI and EcoRI (Addgene plasmid #67788). The GFP transfection control plasmid ...
-
bioRxiv - Biochemistry 2021Quote: ... The resulting chimera genes for the light chain and the His-tagged heavy chain of the Fabs were separately cloned into the pCAGEN vector (a gift from Connie Cepko (Addgene plasmid #11160)) 34 ...
-
bioRxiv - Biochemistry 2020Quote: ... coli RP hk339-GFP (monomeric His-tagged Kif5B kinesin motor domain) expression plasmid was a gift from Ron Vale (Addgene plasmid #24431).
-
bioRxiv - Neuroscience 2023Quote: ... 2.3 x 1013 vg/mL) or 200 nL/side AAV5-CMV-HI-eGFP-Cre-WPRE-SV4 (Addgene; ≥ 1 x 1013 vg/mL) was injected at a rate of 100 nL/min into the insula of Pdynlox/lox and Oprk1lox/lox mice ...
-
bioRxiv - Molecular Biology 2024Quote: The HTLV-1 CA (Gag amino acids 132-349) was cloned into the 6×His SUMO bacterial expression plasmid (pHYRSF53, Addgene, Watertown, MA), with mutants created by using the Gibson assembly procedure ...
-
bioRxiv - Cell Biology 2020Quote: ... VSV-G-tagged human Lrp6 was obtained from Addgene (27282), amplified by PCR using primers containing Gateway sequences ...
-
A human cancer cell line initiates DNA replication normally in the absence of ORC5 and ORC2 proteinsbioRxiv - Molecular Biology 2020Quote: ... Human codon optimized Cas9 nuclease (hCas9) was used (Addgene (41815)) ...
-
bioRxiv - Cell Biology 2019Quote: A human CRISPR KO Pooled Library (GeCKO v2) (Addgene, 1000000048) was used to introduce mutations in the H4-tfLC3B genome ...
-
bioRxiv - Cell Biology 2020Quote: Human PKM2 wild-type construct was purchased from Addgene (44242) and sub-cloned to pCMV-Tag2B plasmid (Agilent Technologies) ...
-
bioRxiv - Immunology 2022Quote: ... The human TdT cDNA was cloned into CTV (Addgene #15912) construct in which the TdT expression was driven by CAG promotor and followed by a EGFP expression that mediated by an internal ribosome entry site (IRES ...
-
bioRxiv - Immunology 2022Quote: ... The human TdT cDNA was cloned into CTV (Addgene #15912) construct in which the TdT expression was driven by CAG promotor and followed by a EGFP expression that mediated by an internal ribosome entry site (IRES ...
-
bioRxiv - Biophysics 2019Quote: The human Sox2 and Oct4 genes were purchased from Addgene and the human c-Myc and Max genes were amplified from HeLa cell cDNA (US Biological T5595-0449) ...
-
bioRxiv - Biophysics 2019Quote: ... human α-actinin 1 cDNA (Addgene; pEGFP-N1 alpha-actin1) was truncated at the actin binding domain (Asp1-Ala247) ...
-
bioRxiv - Cancer Biology 2020Quote: ... the Brunello Human CRISPR knockout pooled lentiviral library (Addgene 73179) was used23 ...
-
bioRxiv - Cancer Biology 2020Quote: ... the Brunello Human CRISPR knockout pooled lentiviral library (Addgene 73179) was used (33) ...
-
bioRxiv - Genetics 2020Quote: ... we amplified human ACE2 (hACE2) from pcDNA3.1-ACE2 (Addgene 1786) and cloned it into a lentiviral transfer pLEX vector carrying the hygromycin resistance gene using Gibson Assembly Master Mix (NEB E2611L) ...
-
bioRxiv - Neuroscience 2020Quote: pET/Calmodulin construct: Untagged human calmodulin was amplified from Addgene plasmid #47603 via PCR and cloned into an empty pET/T7 expression vector (gift from H.J ...
-
bioRxiv - Cell Biology 2020Quote: Human intestinal enteroids (HIEs) were transduced with pABpuro-BluF (Addgene) plasmid DNA containing 1kb of the mouse Bmal1 promoter fused to luciferase (Bmal1-luciferase)29 ...
-
bioRxiv - Cancer Biology 2022Quote: A human SLC knockout library [40] was purchased from Addgene, (Cat ...
-
bioRxiv - Neuroscience 2022Quote: Human DAT cDNA was amplified from YFP-hDAT (Addgene, 90228) and pHluorin was amplified from vGlut1-pHluorin (a gift from Timothy A ...
-
bioRxiv - Neuroscience 2023Quote: ... For the transfection with human Pdhk1 clone (hPdhk1; Addgene: 20564). Pre-OLs after partial differentiation for 4 days from the OPCs ...
-
bioRxiv - Neuroscience 2023Quote: ... full length human TPPP (BC131506) and αSynuclein (MJFF Addgene 51486) were cloned into modified pHAT bacterial expression vectors as previously described (Fu et al ...
-
bioRxiv - Cell Biology 2023Quote: ... and human p55γ were obtained from Addgene (#1407, #70458, # 70459). The plasmid of human p85α was obtained from DNASU ...
-
bioRxiv - Cancer Biology 2023Quote: The cDNA encoding human MED4 was obtained from Addgene (15425). The cDNA was sub-cloned in FLAG-HA-pcDNA3.1- (Addgene ...
-
bioRxiv - Developmental Biology 2023Quote: ... and human rhinovirus 3C protease (HRV 3Cp; Addgene Plasmid #78571) were gifts from David Waugh (71–73) ...
-
IpaA reveals distinct modes of vinculin activation during Shigella invasion and cell-matrix adhesionbioRxiv - Cell Biology 2023Quote: ... The pmCherry-N1-human vinculin (HV) and was from Addgene. Mutations in D1D2 were transferred in mCherry-HV by exchanging the NheI-PspXI fragment with the corresponding XbaI-PspXI fragment of pET15b-D1D2 ...
-
bioRxiv - Immunology 2023Quote: ... pcDNA3-Myc-ASC plasmid encoding human ASC (Addgene plasmid # 73952) were gifts from Christian Stehlik62 ...
-
bioRxiv - Immunology 2023Quote: ... and human IRF3-V5 (plasmid 32713) were purchased from AddGene. All DNA primers and synthesized genes were from IDT (Coralville ...
-
bioRxiv - Cancer Biology 2024Quote: The human CRISPR Brunello lentiviral pooled library (Addgene # 73178-LV)14 and human CRISPR Dolcetto (Set A ...
-
bioRxiv - Immunology 2024Quote: ... Human Kinome CRISPR Knockout Library was from Addgene (catalog #1000000082) and prepared as described (Doench et al. ...
-
bioRxiv - Molecular Biology 2020Quote: ... and UL87 were PCR amplified from these plasmids and cloned into BamHI/XhoI-cut pcDNA4/TO-2xStrep (C-terminal tag) using InFusion cloning (Addgene #138441-138452). Chimeras of the minimal domain (NTD ...
-
bioRxiv - Molecular Biology 2021Quote: ... ΔIDR-SHARP) were then recombined into two different modified versions of the doxycycline inducible PiggyBac destination vector PB-TAG-ERN (Addgene plasmid 80476) containing NGFR (truncated human nerve growth factor receptor ...
-
bioRxiv - Biochemistry 2021Quote: ... PLpro DNA was subcloned into the biGBac vector pLIB [29] to include an N-terminal 3xFlag-His6 tag (sequence: MDYKDHDGDYKDHDIDYKDDDDKGSHHHHHHSAVLQ) (Addgene ID 169194). Baculoviruses were generated using the EMBacY baculoviral genome [30] in Sf9 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Genomics 2022Quote: ... BPTF BD with an N-terminal 6xHistidine (6His) tag and Tobacco Etch Virus (TEV) Protease cleavage site was from Addgene (plasmid 39111). This was modified using the Q5 Site-directed mutagenesis kit (New England Biolabs [NEB] ...
-
bioRxiv - Microbiology 2022Quote: ... full length 3CLpro coding-sequences with N-terminal 6His tags were synthesized by Integrated DNA Technologies (Coralville, IA) and cloned into pET-28a(+) vector (Addgene, Cambridge, MA). Subsequently ...
-
bioRxiv - Biophysics 2022Quote: ... media was refreshed with standard growth media and cells were co-transfected with SNAP-mGluR2 (no FLAG-tag) and chimeric G protein (Gqo5, Addgene plasmid #24500) (1:2 w/w ...
-
bioRxiv - Developmental Biology 2022Quote: The pTT3-eGFP vector was constructed by replacing the C-terminal tag encoding region of a bait protein vector (52) (Addgene ID 36150) with eGFP ...
-
bioRxiv - Molecular Biology 2019Quote: ... ORF66 was subcloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag) to generate pcDNA4/TO-ORF66-2xStrep (Addgene plasmid #130953). ORF66 aa 1-200 was cloned into the NotI and XhoI sites of pcDNA4/TO-2xStrep (N-terminal tag ...
-
bioRxiv - Molecular Biology 2019Quote: ... ORF66 aa 1-200 was cloned into the NotI and XhoI sites of pcDNA4/TO-2xStrep (N-terminal tag) to generate pcDNA4/TO-2xStrep-ORF66 1-200 (Addgene plasmid #130954) and ORF66 aa 200-429 was cloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag ...
-
bioRxiv - Molecular Biology 2019Quote: ... and ORF66 aa 200-429 was cloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag) to generate pcDNA4/TO-ORF66 200-429-2xStrep (Addgene plasmid #130955). Point mutations in pcDNA4/TO-ORF66-2xStrep (Addgene plasmids #131109-131121 ...
-
bioRxiv - Genetics 2021Quote: RPA1 expression constructs were generated as derivatives of a RPA1-WT expression construct pLX304-hRPA1 bearing bearing an N-ter V5 tag (Addgene Plasmid #25890). The R41E ...
-
bioRxiv - Biochemistry 2021Quote: ... For AKAR4 purification, an 8His epitope tag was ligated into pcDNA3.1- AKAR4-NES vector (Depry et al., 2011) (Addgene cat no. 64727) at the C-terminus of the sensor immediately prior to the nuclear export site using primers EcoI_8HisNLS_XbaI and XbaI_8HisNLS_EcoRI ...
-
bioRxiv - Cell Biology 2020Quote: ... Human ASK3 cDNA was also subcloned into pcDNA3 with a C-terminal tdTomato-tag (cDNA was gifted by M. Davidson, Florida State University, via Addgene: plasmid #54653) or pcDNA4/TO with an N-terminal Venus- or EGFP-FLAG-tag ...
-
bioRxiv - Biochemistry 2021Quote: a codon optimised nagK gene from Plesiomonas shigelloides was cloned into the pOPINS3C expression plasmid (N-terminal polyhistidine and SUMO tags; Addgene #41115 (59)) ...
-
bioRxiv - Molecular Biology 2021Quote: ... TDP-43 bacterial expression vector harboring a C-terminal MBP tag (pJ4M TDP-43-TEV-MBP-6xHis) was purchased from Addgene (Plasmid # 104480). TDP-43 mutations were generated by site-directed mutagenesis using QuikChange (Agilent ...
-
bioRxiv - Genetics 2020Quote: ... as a gene block with a C-terminal HA tag and cloned into pMSCV PIG (Puro IRES GFP empty vector) - a gift from David Bartel (Addgene plasmid # 21654). Retroviruses were generated using the retroPack system (Takara ...
-
bioRxiv - Cell Biology 2023Quote: ... polyspora Hop1319-529 into UC Berkeley Macrolab vectors to generate N-terminal TEV protease-cleavable His6- or His6-maltose binding protein tags (Addgene #29666, 29706). DNA binding mutants of S ...
-
bioRxiv - Cell Biology 2023Quote: ... TDP43 was inserted by Gibson assembly at the C terminus of SNAP-tag (tdp43-EGFP was a gift from Zuoshang Xu, Addgene plasmid # 28198). Plasmids were delivered to cells using Lipofectamine 2000 according to the manufacturer’s instructions ...