Labshake search
Citations for Addgene :
301 - 350 of 728 citations for Borrelia Miyamotoi GlpQ Protein His tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2024Quote: ... and 1x penicillin/streptomycin (pen/strep; PAA) and distributed in 6-well plates with HEK293 cells transfected with Neo1.a-AP-His (Addgene #71963) or pcDNA3.1-CNTN4-FLAG ...
-
bioRxiv - Developmental Biology 2022Quote: ... Samples were incubated with Protein A/G-MNase fusion protein (Addgene, Cat #123461) at 700 ng/mL for 1 hour at 4°C ...
-
bioRxiv - Molecular Biology 2020Quote: ... A C-terminal Strep tag on ORF24-NTD was added by inverse PCR to generate p6H-SUMO3-ORF24-NTD-Strep (Addgene #138467).
-
bioRxiv - Molecular Biology 2020Quote: ... Full-length UL87 was PCR amplified from HCMV Towne BAC DNA with primers to introduced EcoRI and XhoI sites and cloned into pcDNA4/TO-2xStrep (C-terminal tag) using T4 DNA ligase (Addgene #138434). Full-length mu24 was PCR amplified from MHV68-infected 3T3 cell cDNA with primers to introduce BamHI and NotI sites and cloned into pcDNA4/TO-2xStrep (C-terminal tag ...
-
bioRxiv - Molecular Biology 2020Quote: ... We built plasmids by Gibson assembly for constitutive expression of histones and K27M mutant histones tagged at their C-termini with 2XFLAG epitope tags using the Copia promoter from the plasmid pCoPURO (Addgene 17533), and Drosophila H3 and H3.3 histones from previously published constructs (Ahmad & Henikoff ...
-
bioRxiv - Biophysics 2022Quote: ... NCBI Accession YP_009820873.1) were cloned with an N-terminal TEV protease-cleavable His6-tag using UC Berkeley Macrolab vector 2-BT (Addgene #29666). Truncations and other modified constructs were cloned by PCR mutagenesis and isothermal assembly ...
-
bioRxiv - Genomics 2019Quote: ... 2012) Flag tag and MCS was cloned into the pMT-puro expression plasmid (a gift from David Sabatini, Addgene plasmid # 17923). Drosophila cDNA or the cDNA for the eGFP protein was then cloned into the resultant expression plasmid ...
-
bioRxiv - Plant Biology 2019Quote: ... thaliana accession Columbia as well as eYFP from pBlunt-EYFP-TAG 52 and mRuby2 CDS from pcDNA3-mRuby2 53(plasmid #40260; Addgene, www.addgene.com) were PCR amplified ...
-
bioRxiv - Molecular Biology 2019Quote: ... Retroviral vectors for JMJD6 expression were generated by cloning the Jmjd6 coding sequence with a C-terminal FLAG-tag sequence (11) into the pBABE plasmid vector containing the neomycin resistance gene (Addgene #1767). Mutant versions of JMJD6 were generated from the wild type construct using QuikChange Lightning site-directed mutagenesis kit (Agilent) ...
-
bioRxiv - Plant Biology 2019Quote: ... HR2 was amplified from Col-0 (Fw: GGCTTAAUATGCCTCTTACCGAGATTATCG, Rv: AACCCGAUTTCAAAACGAAGCGAATTC) and mNeon c-terminal tag was amplified from pICSL50015 (Addgene: 50318) (Fw ...
-
bioRxiv - Biophysics 2021Quote: ... Fractions containing the target proteins were dialyzed against PBS (pH 7.4) and the His6-SUMO-tag was removed by enzymatic cleavage using human SENP1 protease at 4°C overnight (Addgene #16356) (51) ...
-
bioRxiv - Biophysics 2020Quote: ... The homologous recombination donor (HRD) was generated by EGFP tag and Sec61b cDNA (a gift from Dr. Jennifer Lippincott-Schwartz, Addgene #90992) into AAVS1-TRE3G-EGFP (a gift from Su-Chun Zhang ...
-
bioRxiv - Cell Biology 2021Quote: ... codon optimized coding sequences with a C-terminal HA epitope tag were synthesized by IDT and cloned into a pCW57.1 (Addgene plasmid #41393) derived lentiviral vector with a blasticidin resistance gene (replacing the original puromycin resistance gene) ...
-
bioRxiv - Microbiology 2020Quote: Epitope-tagged expression constructs were made by first cloning cDNAs from RAW 264.7 cell RNA into pENTR1a entry vectors with indicated tags (Addgene Plasmid #17396)(Campeau et al. ...
-
bioRxiv - Neuroscience 2020Quote: ... and the triple HA tag (gray highlighted text) replaced the mEGFP-cmak2a HDR cassette in the backbone of the pAAV-HDR-mEGFP-camk2a (Addgene #104589). This construct ...
-
bioRxiv - Neuroscience 2020Quote: ... with a pEGFP-C1 mammalian vector containing full length human A53T variant αSyn with a fusion EGFP tag (Addgene, Plasmid #40823), following the manufacturer’s protocol ...
-
bioRxiv - Biophysics 2020Quote: ... was expressed in E.coli using gene with an N-terminal 6XHis-tag and up stream TEV-protease site cloned into pET28a(+) (Addgene plasmid #2006150). MSP1D1 was purified using IMAC72 with further cleavage of 6xHis-tag by TEV protease (Sigma-Aldrich) ...
-
bioRxiv - Cancer Biology 2021Quote: Previously described pMIG-Aalpha WT retroviral vector with a Flag-tag at the NH2 terminal (32) obtained from Addgene (plasmid #10884) was generously provided by William Hahn ...
-
bioRxiv - Biochemistry 2022Quote: ... Full-length human KRAS4B G12C was ectopically expressed from the retroviral expression vector pBABE containing an N-terminal HA-tag (Addgene #58901). Viral particles were generated by transient transfection of each expression vector into HEK 293T cells using Fugene6 (Promega ...
-
bioRxiv - Biochemistry 2022Quote: ... plasmid to produce a construct carrying a N-terminal hexahistidine and hexahistidine-SUMO tag followed by a TEV cleavage site and the ShTniQ was cloned into the 1C (Addgene 29659) vector generating a construct carrying a hexahistidine-maltose binding protein (6xHis-MBP ...
-
bioRxiv - Immunology 2020Quote: ... Human orfeome clone 10217) was gateway cloned into an attR-destination vector encoding an N-terminal FLAG tag (Addgene, Plasmid #18700), with the Gateway™ LR Clonase™ II Enzyme mix (ThermoFisher ...
-
bioRxiv - Molecular Biology 2020Quote: ... Full-length BcRF1 was PCR amplified from pcDNA4/TO-BcRF1-3xFLAG (19) and cloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag) using InFusion cloning (Addgene #138436). Mutations of the RLLLG motif in UL87 ...
-
bioRxiv - Molecular Biology 2020Quote: ... Full-length mu24 was PCR amplified from MHV68-infected 3T3 cell cDNA with primers to introduce BamHI and NotI sites and cloned into pcDNA4/TO-2xStrep (C-terminal tag) using T4 DNA ligase (Addgene #138435). Full-length BcRF1 was PCR amplified from pcDNA4/TO-BcRF1-3xFLAG (19 ...
-
bioRxiv - Genetics 2020Quote: Human codon-optimized high fidelity Cas9 nuclease construct with GFP tag (pSpCas9(BB)-2A-GFP (PX458))80 was obtained from Addgene (#48138). Two sgRNAs were designed using CRISPR-Cas9 guide RNA design checker from Integrated DNA Technologies ...
-
bioRxiv - Cell Biology 2021Quote: ... A gBlock containing sequence for SNAP-V5 tags was inserted into pLenti CMVTRE3G eGFP Blast (w818-1) (gift of Eric Campenau, Addgene #27568) at the AgeI restriction site using Gibson Assembly to make pLTRE3G-SNAP-V5-eGFP ...
-
bioRxiv - Neuroscience 2021Quote: Full-length human APLP1 gene with a Flag tag in the N-terminal was cloned from pCAX APLP1 (Addgene plasmid#30141) and the primers were shown in Key Resources Table (NheI-Flg-hAPLP1-F/XhoI-His-hAPLP1-R) ...
-
bioRxiv - Cell Biology 2020Quote: hCIB2 was subcloned into pET21a (histidine tag on the C-terminus; hCIB2-6xHis) and GST-Rheb in pGEX-4T-2 (Addgene #15889), transformed in Bl2 (DE3 ...
-
bioRxiv - Cell Biology 2023Quote: ... SNAP-Rab7A and SNAP-Rab7A Q67L were made by cloning Rab7A sequence from EGFP-Rab7A and EGFP-Rab7A Q67L plasmids into pSNAP-tag (m) Vector (Addgene #101135). Soluble BFP (mTagBFP2 ...
-
bioRxiv - Biochemistry 2023Quote: ... The codon optimized AOX with a C-terminal HA tag synthesized by IDT was cloned into pLv-EF1a-IRES-puro (Addgene 85132), pAAV.TBG.PI.eGFP.WPRE.bGH (Addgene 105535) ...
-
bioRxiv - Molecular Biology 2023Quote: A fragment containing an inducible TRE-tight promoter and a LAP tag (a FLAG-tag followed by an EmGFP-tag) was inserted at the XhoI site of the plasmid pBSKDB-CAG-rtTA2sM2-IRES-tSkid-IRES-Neo (Addgene #62346), thereby generating the vector pGEH_ind_LAP-C ...
-
bioRxiv - Microbiology 2023Quote: HPV16 PsVs were produced by co-transfecting 293TT cells with wild-type p16SheLL-3XFLAG tag [14] together with pCAG-HcRed (Addgene #11152) or pCINeo-GFP [obtained from C ...
-
bioRxiv - Biophysics 2023Quote: ... UblBilA was cloned into a vector encoding a C-terminal GFP tag (UC Berkeley Macrolab vector H6-msfGFP, Addgene ID 29725) and purified as above ...
-
bioRxiv - Biochemistry 2023Quote: ... a recombinant fragment comprising part of the CM1 motif of human CDK5RAP251-100 (also referred to as γ-TuNA [32]) fused to a cleavable GFP tag (His6-SUMO-TEV-GFP-PreScission-γ-TuNA, a gift from Tarun Kapoor (Addgene plasmid # 178066 ...
-
bioRxiv - Genomics 2024Quote: ... and the top two scoring sgRNAs for each target gene based on depletion or enrichment phenotypes were cloned into dual sgRNA lentivirus expression vectors with direct capture tags (Addgene 187241)40 using NEBuilder HiFi DNA Assembly Master Mix (New England Biolabs #E2621L ...
-
bioRxiv - Cell Biology 2024Quote: ... The DNA fragment of tight TRE promoter with ATG start codon and 3XFLAG tag was amplified from pCW-Cas9 (Addgene #50661). The DNA fragment of hPGK-PuroR-rTetR was amplified from pCW-Cas9 ...
-
bioRxiv - Microbiology 2024Quote: ... The new product replaced an existing gene when inserted into pcDNA3.1 containing a triple N-FLAG-tag between KpnI and EcoRI (Addgene plasmid #67788). The GFP transfection control plasmid ...
-
bioRxiv - Immunology 2021Quote: ... green fluorescence protein (GFP) or an enhanced yellow fluorescent protein (EYFP) sequence (pcDNA1.3-, Addgene) using standard cloning methods ...
-
bioRxiv - Biochemistry 2021Quote: ... The resulting chimera genes for the light chain and the His-tagged heavy chain of the Fabs were separately cloned into the pCAGEN vector (a gift from Connie Cepko (Addgene plasmid #11160)) 34 ...
-
bioRxiv - Biochemistry 2020Quote: ... coli RP hk339-GFP (monomeric His-tagged Kif5B kinesin motor domain) expression plasmid was a gift from Ron Vale (Addgene plasmid #24431).
-
bioRxiv - Neuroscience 2023Quote: ... 2.3 x 1013 vg/mL) or 200 nL/side AAV5-CMV-HI-eGFP-Cre-WPRE-SV4 (Addgene; ≥ 1 x 1013 vg/mL) was injected at a rate of 100 nL/min into the insula of Pdynlox/lox and Oprk1lox/lox mice ...
-
bioRxiv - Molecular Biology 2024Quote: The HTLV-1 CA (Gag amino acids 132-349) was cloned into the 6×His SUMO bacterial expression plasmid (pHYRSF53, Addgene, Watertown, MA), with mutants created by using the Gibson assembly procedure ...
-
bioRxiv - Genetics 2019Quote: ... mCherry fluorescent protein marker (Addgene), and ampicillin resistance gene ...
-
bioRxiv - Molecular Biology 2020Quote: ... and UL87 were PCR amplified from these plasmids and cloned into BamHI/XhoI-cut pcDNA4/TO-2xStrep (C-terminal tag) using InFusion cloning (Addgene #138441-138452). Chimeras of the minimal domain (NTD ...
-
bioRxiv - Molecular Biology 2021Quote: ... ΔIDR-SHARP) were then recombined into two different modified versions of the doxycycline inducible PiggyBac destination vector PB-TAG-ERN (Addgene plasmid 80476) containing NGFR (truncated human nerve growth factor receptor ...
-
bioRxiv - Biochemistry 2021Quote: ... PLpro DNA was subcloned into the biGBac vector pLIB [29] to include an N-terminal 3xFlag-His6 tag (sequence: MDYKDHDGDYKDHDIDYKDDDDKGSHHHHHHSAVLQ) (Addgene ID 169194). Baculoviruses were generated using the EMBacY baculoviral genome [30] in Sf9 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Genomics 2022Quote: ... BPTF BD with an N-terminal 6xHistidine (6His) tag and Tobacco Etch Virus (TEV) Protease cleavage site was from Addgene (plasmid 39111). This was modified using the Q5 Site-directed mutagenesis kit (New England Biolabs [NEB] ...
-
bioRxiv - Microbiology 2022Quote: ... full length 3CLpro coding-sequences with N-terminal 6His tags were synthesized by Integrated DNA Technologies (Coralville, IA) and cloned into pET-28a(+) vector (Addgene, Cambridge, MA). Subsequently ...
-
bioRxiv - Molecular Biology 2019Quote: ... ORF66 was subcloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag) to generate pcDNA4/TO-ORF66-2xStrep (Addgene plasmid #130953). ORF66 aa 1-200 was cloned into the NotI and XhoI sites of pcDNA4/TO-2xStrep (N-terminal tag ...
-
bioRxiv - Molecular Biology 2019Quote: ... ORF66 aa 1-200 was cloned into the NotI and XhoI sites of pcDNA4/TO-2xStrep (N-terminal tag) to generate pcDNA4/TO-2xStrep-ORF66 1-200 (Addgene plasmid #130954) and ORF66 aa 200-429 was cloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag ...
-
bioRxiv - Molecular Biology 2019Quote: ... and ORF66 aa 200-429 was cloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag) to generate pcDNA4/TO-ORF66 200-429-2xStrep (Addgene plasmid #130955). Point mutations in pcDNA4/TO-ORF66-2xStrep (Addgene plasmids #131109-131121 ...