Labshake search
Citations for Addgene :
401 - 450 of 1021 citations for Human MXRA8 His tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2024Quote: ... The new product replaced an existing gene when inserted into pcDNA3.1 containing a triple N-FLAG-tag between KpnI and EcoRI (Addgene plasmid #67788). The GFP transfection control plasmid ...
-
bioRxiv - Biochemistry 2021Quote: ... The resulting chimera genes for the light chain and the His-tagged heavy chain of the Fabs were separately cloned into the pCAGEN vector (a gift from Connie Cepko (Addgene plasmid #11160)) 34 ...
-
bioRxiv - Biochemistry 2020Quote: ... coli RP hk339-GFP (monomeric His-tagged Kif5B kinesin motor domain) expression plasmid was a gift from Ron Vale (Addgene plasmid #24431).
-
bioRxiv - Neuroscience 2023Quote: ... 2.3 x 1013 vg/mL) or 200 nL/side AAV5-CMV-HI-eGFP-Cre-WPRE-SV4 (Addgene; ≥ 1 x 1013 vg/mL) was injected at a rate of 100 nL/min into the insula of Pdynlox/lox and Oprk1lox/lox mice ...
-
bioRxiv - Molecular Biology 2024Quote: The HTLV-1 CA (Gag amino acids 132-349) was cloned into the 6×His SUMO bacterial expression plasmid (pHYRSF53, Addgene, Watertown, MA), with mutants created by using the Gibson assembly procedure ...
-
bioRxiv - Cell Biology 2020Quote: ... VSV-G-tagged human Lrp6 was obtained from Addgene (27282), amplified by PCR using primers containing Gateway sequences ...
-
A human cancer cell line initiates DNA replication normally in the absence of ORC5 and ORC2 proteinsbioRxiv - Molecular Biology 2020Quote: ... Human codon optimized Cas9 nuclease (hCas9) was used (Addgene (41815)) ...
-
bioRxiv - Cell Biology 2019Quote: A human CRISPR KO Pooled Library (GeCKO v2) (Addgene, 1000000048) was used to introduce mutations in the H4-tfLC3B genome ...
-
bioRxiv - Cell Biology 2020Quote: Human PKM2 wild-type construct was purchased from Addgene (44242) and sub-cloned to pCMV-Tag2B plasmid (Agilent Technologies) ...
-
bioRxiv - Immunology 2022Quote: ... The human TdT cDNA was cloned into CTV (Addgene #15912) construct in which the TdT expression was driven by CAG promotor and followed by a EGFP expression that mediated by an internal ribosome entry site (IRES ...
-
bioRxiv - Immunology 2022Quote: ... The human TdT cDNA was cloned into CTV (Addgene #15912) construct in which the TdT expression was driven by CAG promotor and followed by a EGFP expression that mediated by an internal ribosome entry site (IRES ...
-
bioRxiv - Biophysics 2019Quote: The human Sox2 and Oct4 genes were purchased from Addgene and the human c-Myc and Max genes were amplified from HeLa cell cDNA (US Biological T5595-0449) ...
-
bioRxiv - Biophysics 2019Quote: ... human α-actinin 1 cDNA (Addgene; pEGFP-N1 alpha-actin1) was truncated at the actin binding domain (Asp1-Ala247) ...
-
bioRxiv - Cancer Biology 2020Quote: ... the Brunello Human CRISPR knockout pooled lentiviral library (Addgene 73179) was used23 ...
-
bioRxiv - Cancer Biology 2020Quote: ... the Brunello Human CRISPR knockout pooled lentiviral library (Addgene 73179) was used (33) ...
-
bioRxiv - Genetics 2020Quote: ... we amplified human ACE2 (hACE2) from pcDNA3.1-ACE2 (Addgene 1786) and cloned it into a lentiviral transfer pLEX vector carrying the hygromycin resistance gene using Gibson Assembly Master Mix (NEB E2611L) ...
-
bioRxiv - Neuroscience 2020Quote: pET/Calmodulin construct: Untagged human calmodulin was amplified from Addgene plasmid #47603 via PCR and cloned into an empty pET/T7 expression vector (gift from H.J ...
-
bioRxiv - Cell Biology 2020Quote: Human intestinal enteroids (HIEs) were transduced with pABpuro-BluF (Addgene) plasmid DNA containing 1kb of the mouse Bmal1 promoter fused to luciferase (Bmal1-luciferase)29 ...
-
bioRxiv - Cancer Biology 2022Quote: A human SLC knockout library [40] was purchased from Addgene, (Cat ...
-
bioRxiv - Neuroscience 2022Quote: Human DAT cDNA was amplified from YFP-hDAT (Addgene, 90228) and pHluorin was amplified from vGlut1-pHluorin (a gift from Timothy A ...
-
bioRxiv - Neuroscience 2023Quote: ... For the transfection with human Pdhk1 clone (hPdhk1; Addgene: 20564). Pre-OLs after partial differentiation for 4 days from the OPCs ...
-
bioRxiv - Neuroscience 2023Quote: ... full length human TPPP (BC131506) and αSynuclein (MJFF Addgene 51486) were cloned into modified pHAT bacterial expression vectors as previously described (Fu et al ...
-
bioRxiv - Cell Biology 2023Quote: ... and human p55γ were obtained from Addgene (#1407, #70458, # 70459). The plasmid of human p85α was obtained from DNASU ...
-
bioRxiv - Immunology 2023Quote: ... pcDNA3-Myc-ASC plasmid encoding human ASC (Addgene plasmid # 73952) were gifts from Christian Stehlik62 ...
-
bioRxiv - Cancer Biology 2023Quote: The cDNA encoding human MED4 was obtained from Addgene (15425). The cDNA was sub-cloned in FLAG-HA-pcDNA3.1- (Addgene ...
-
IpaA reveals distinct modes of vinculin activation during Shigella invasion and cell-matrix adhesionbioRxiv - Cell Biology 2023Quote: ... The pmCherry-N1-human vinculin (HV) and was from Addgene. Mutations in D1D2 were transferred in mCherry-HV by exchanging the NheI-PspXI fragment with the corresponding XbaI-PspXI fragment of pET15b-D1D2 ...
-
bioRxiv - Immunology 2024Quote: ... Human Kinome CRISPR Knockout Library was from Addgene (catalog #1000000082) and prepared as described (Doench et al. ...
-
bioRxiv - Developmental Biology 2023Quote: ... and human rhinovirus 3C protease (HRV 3Cp; Addgene Plasmid #78571) were gifts from David Waugh (71–73) ...
-
bioRxiv - Cancer Biology 2024Quote: The human CRISPR Brunello lentiviral pooled library (Addgene # 73178-LV)14 and human CRISPR Dolcetto (Set A ...
-
bioRxiv - Immunology 2023Quote: ... and human IRF3-V5 (plasmid 32713) were purchased from AddGene. All DNA primers and synthesized genes were from IDT (Coralville ...
-
bioRxiv - Molecular Biology 2020Quote: ... and UL87 were PCR amplified from these plasmids and cloned into BamHI/XhoI-cut pcDNA4/TO-2xStrep (C-terminal tag) using InFusion cloning (Addgene #138441-138452). Chimeras of the minimal domain (NTD ...
-
bioRxiv - Molecular Biology 2021Quote: ... ΔIDR-SHARP) were then recombined into two different modified versions of the doxycycline inducible PiggyBac destination vector PB-TAG-ERN (Addgene plasmid 80476) containing NGFR (truncated human nerve growth factor receptor ...
-
bioRxiv - Biochemistry 2021Quote: ... PLpro DNA was subcloned into the biGBac vector pLIB [29] to include an N-terminal 3xFlag-His6 tag (sequence: MDYKDHDGDYKDHDIDYKDDDDKGSHHHHHHSAVLQ) (Addgene ID 169194). Baculoviruses were generated using the EMBacY baculoviral genome [30] in Sf9 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Genomics 2022Quote: ... BPTF BD with an N-terminal 6xHistidine (6His) tag and Tobacco Etch Virus (TEV) Protease cleavage site was from Addgene (plasmid 39111). This was modified using the Q5 Site-directed mutagenesis kit (New England Biolabs [NEB] ...
-
bioRxiv - Microbiology 2022Quote: ... full length 3CLpro coding-sequences with N-terminal 6His tags were synthesized by Integrated DNA Technologies (Coralville, IA) and cloned into pET-28a(+) vector (Addgene, Cambridge, MA). Subsequently ...
-
bioRxiv - Biophysics 2022Quote: ... media was refreshed with standard growth media and cells were co-transfected with SNAP-mGluR2 (no FLAG-tag) and chimeric G protein (Gqo5, Addgene plasmid #24500) (1:2 w/w ...
-
bioRxiv - Developmental Biology 2022Quote: The pTT3-eGFP vector was constructed by replacing the C-terminal tag encoding region of a bait protein vector (52) (Addgene ID 36150) with eGFP ...
-
bioRxiv - Molecular Biology 2019Quote: ... ORF66 was subcloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag) to generate pcDNA4/TO-ORF66-2xStrep (Addgene plasmid #130953). ORF66 aa 1-200 was cloned into the NotI and XhoI sites of pcDNA4/TO-2xStrep (N-terminal tag ...
-
bioRxiv - Molecular Biology 2019Quote: ... ORF66 aa 1-200 was cloned into the NotI and XhoI sites of pcDNA4/TO-2xStrep (N-terminal tag) to generate pcDNA4/TO-2xStrep-ORF66 1-200 (Addgene plasmid #130954) and ORF66 aa 200-429 was cloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag ...
-
bioRxiv - Molecular Biology 2019Quote: ... and ORF66 aa 200-429 was cloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag) to generate pcDNA4/TO-ORF66 200-429-2xStrep (Addgene plasmid #130955). Point mutations in pcDNA4/TO-ORF66-2xStrep (Addgene plasmids #131109-131121 ...
-
bioRxiv - Genetics 2021Quote: RPA1 expression constructs were generated as derivatives of a RPA1-WT expression construct pLX304-hRPA1 bearing bearing an N-ter V5 tag (Addgene Plasmid #25890). The R41E ...
-
bioRxiv - Biochemistry 2021Quote: ... For AKAR4 purification, an 8His epitope tag was ligated into pcDNA3.1- AKAR4-NES vector (Depry et al., 2011) (Addgene cat no. 64727) at the C-terminus of the sensor immediately prior to the nuclear export site using primers EcoI_8HisNLS_XbaI and XbaI_8HisNLS_EcoRI ...
-
bioRxiv - Cell Biology 2020Quote: ... Human ASK3 cDNA was also subcloned into pcDNA3 with a C-terminal tdTomato-tag (cDNA was gifted by M. Davidson, Florida State University, via Addgene: plasmid #54653) or pcDNA4/TO with an N-terminal Venus- or EGFP-FLAG-tag ...
-
bioRxiv - Biochemistry 2021Quote: a codon optimised nagK gene from Plesiomonas shigelloides was cloned into the pOPINS3C expression plasmid (N-terminal polyhistidine and SUMO tags; Addgene #41115 (59)) ...
-
bioRxiv - Molecular Biology 2021Quote: ... TDP-43 bacterial expression vector harboring a C-terminal MBP tag (pJ4M TDP-43-TEV-MBP-6xHis) was purchased from Addgene (Plasmid # 104480). TDP-43 mutations were generated by site-directed mutagenesis using QuikChange (Agilent ...
-
bioRxiv - Genetics 2020Quote: ... as a gene block with a C-terminal HA tag and cloned into pMSCV PIG (Puro IRES GFP empty vector) - a gift from David Bartel (Addgene plasmid # 21654). Retroviruses were generated using the retroPack system (Takara ...
-
bioRxiv - Cell Biology 2023Quote: ... polyspora Hop1319-529 into UC Berkeley Macrolab vectors to generate N-terminal TEV protease-cleavable His6- or His6-maltose binding protein tags (Addgene #29666, 29706). DNA binding mutants of S ...
-
bioRxiv - Cell Biology 2023Quote: ... TDP43 was inserted by Gibson assembly at the C terminus of SNAP-tag (tdp43-EGFP was a gift from Zuoshang Xu, Addgene plasmid # 28198). Plasmids were delivered to cells using Lipofectamine 2000 according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2023Quote: ... with N-terminal HA tag added into primers followed by insertion into NotI/EcoRI-linearized pGCGFP-G418 (a gift from Andrew Pierce, Addgene plasmid #31264) using In-Fusion HD (Takara Bio) ...
-
bioRxiv - Biochemistry 2024Quote: The plasmid encoding amino acids 1-393 of the p53 protein with a FLAG tag at the C-terminus (Addgene plasmid #10838) was used as a template for site-directed mutagenesis to delete the N-terminal regions spanning amino acids 1-31 ...