-
No products found
because this supplier's products are not listed.
Madeleine F. Jennewein, et al.,
bioRxiv - Immunology 2021
Quote:
To investigate Fc receptor binding recombinant Fc receptors with an AviTag were biotinylated using a Bir500 kit (Avidity, Aurora, CO, USA) according to manufacturer’s instructions and purified using a Zeba Spin Desalting Column ...
-
No products found
because this supplier's products are not listed.
Ronan W. O’Connell, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... Level 3 166k-member assemblies were purified using a miniprep column (Epoch Life Sciences), electroporated (BioRad ...
-
No products found
because this supplier's products are not listed.
Vincent Soubannier, et al.,
bioRxiv - Neuroscience 2019
Quote:
... human iPSC-derived astrocytes were incubated with tumour necrosis factor alpha (TNFa) (30 ng/ml; Cell Sciences; Newburyport, MA; Cat. No. CRT100B), interleukin alpha (IL-1a ...
-
No products found
because this supplier's products are not listed.
Jenna J. Guthmiller, et al.,
bioRxiv - Immunology 2021
Quote:
... 1 part serum was treated with 3 parts Receptor Destroying Enzyme II (Seiken, Hardy Diagnostics) for 18 hours at 37°C ...
-
No products found
because this supplier's products are not listed.
MT Heemskerk, et al.,
bioRxiv - Immunology 2021
Quote:
... diluted in PBS for 10 min at RT and Fc-receptors were subsequently blocked using 5% human serum (HS; Sanquin Blood bank, Amsterdam, The Netherlands) for 45 min at RT ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
Justine Creff, et al.,
bioRxiv - Cell Biology 2022
Quote:
... 200 µg for HEK293) were incubated with 3 µg of the indicated antibodies and 12 µL protein sepharose beads (IPA300, Repligen) at 4°C for 4 h ...
-
Gelatin methacrylate (GelMA) is a gelatin-based bioink that provides mammalian cells with the...
Cat# IK3051020303,
3 mL, USD $310.0
Ask
Lauren J. Lahey, et al.,
bioRxiv - Biochemistry 2020
Quote:
HEK293 cell lines were seeded in PurCol-coated (Advanced BioMatrix) 6-well plates at 300,000 total cells in 2 mL media one day before transfection ...
-
No products found
because this supplier's products are not listed.
Linyuan Shi, et al.,
bioRxiv - Neuroscience 2023
Quote:
... The GABAA receptor positive allosteric modulator indiplon (AdooQ Biosciences) or the GSK3β inhibitor AR-A104418 (AdooQ Biosciences ...
-
No products found
because this supplier's products are not listed.
Michael P. Plebanek, et al.,
bioRxiv - Immunology 2023
Quote:
The BRAFV600E PTEN-/- melanoma cell line was generated by spontaneous immortalization of a tumor resected from the BRAFCA;PTENlox/lox;Tyr::CreERT2 mouse model (13) and cultured in DMEM containing 10% FBS (Genesee Scientific, Cat# 25-550) and 1% antibiotic-antimycotic (ThermoFisher Cat ...
-
Cat# Ltbr-1219M,
10ug : USD $798
Ask
Sunil Yeruva, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Recombinant protein of human DSG2 tagged with IgG Fc domain (Fc) (Creative Biomart; #DSG2-1601H) and N-CAD-Fc (Sino Biological ...
-
No products found
because this supplier's products are not listed.
Matthew D. J. Dicks, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Human coagulation Factor X (hFX) (Haematologic Technologies) was added to diluted vectors at a final concentration of 8 μg/mL ...
-
No products found
because this supplier's products are not listed.
Marisol Sampedro-Castañeda, et al.,
bioRxiv - Neuroscience 2023
Quote:
... rabbit anti Cav2.3 N-terminus 1:250 (Covalab, custom 1, HEK293 & brain), rabbit anti pS15 Cav2.3 1:500 (Covalab ...
-
No products found
because this supplier's products are not listed.
Thomas D. Avery, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
NRF2/ARE luciferase reporter HEK293 cells (SL-0042-NP, Signosis, Santa Clara, USA) were maintained in Dulbecco’s Modified Eagle’s Medium (DMEM ...
-
No products found
because this supplier's products are not listed.
Juliane Tschuck, et al.,
bioRxiv - Cell Biology 2023
Quote:
For inhibition of different receptors and proteins we used HX 531 (Biomol) as a pan-Retinoic Acid Receptor (RAR ...
-
No products found
because this supplier's products are not listed.
Kanae Tsubotani, et al.,
bioRxiv - Biochemistry 2021
Quote:
... FITC-labelled lysozyme (LS1-FC-1, Nanocs Inc., USA) instead of lysozyme was mixed with ovalbumin in 5mM Tris buffer (pH 7.4) ...
-
No products found
because this supplier's products are not listed.
Adam B. Francisco, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... Frozen tumors underwent physical dissociation using a polytron PT1200 E homogenizer (Thomas Scientific, Swedesboro, NJ) and total RNA was isolated using the Total RNA Purification Kit (Norgen Biotek ...
-
No products found
because this supplier's products are not listed.
Kate E. Cavanaugh, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and CO2 control (Chamlide TC and FC-5N; Quorum Technologies). All pieces of the stage incubator (stage ...
-
No products found
because this supplier's products are not listed.
Bas W.A. Bögels, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide HCl (EDC, Carbosynth), 1,6-diaminohexane (Sigma ...
-
No products found
because this supplier's products are not listed.
Diana D. Shi, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... tumor tissue was collected from the operating room and suspended in ice cold Hibernate A (BrainBits HA). Tumor pieces were exposed to RBC lysis buffer (Thermo Fisher 00433357 ...
-
No products found
because this supplier's products are not listed.
Jeong Min Lee, et al.,
bioRxiv - Biochemistry 2024
Quote:
... supplemented with human Stem Cell Factor (SCF,100 ng/ml) (CellGenix, 1418-050), FMS-like Tyrosine Kinase 3 Ligand (Flt3L ...
-
No products found
because this supplier's products are not listed.
Kyung Ku Jang, et al.,
bioRxiv - Cell Biology 2022
Quote:
... The permeabilized organoids were washed 3 times with PBS and incubated with mouse anti-SARS-CoV-2 N antibody (1:1,000, ProSci, 10-605) and rabbit anti-ACE2 antibody (1:500 ...
-
No products found
because this supplier's products are not listed.
Donggi Paik, et al.,
bioRxiv - Immunology 2021
Quote:
... 3-oxoLCA (Steraloids (C1750-000 ...
-
No products found
because this supplier's products are not listed.
Mei Lin, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and the PH domains from phospholipase C-δ1 (PLCδ-PH) and general receptor for phosphoinositides (GRP1-PH) were constructed by cloning PCR-amplified cDNA into pET-SUMO vector (LifeSensors), in frame with the N-terminal 6His-SUMO tag ...
-
No products found
because this supplier's products are not listed.
Assaf Alon, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
Purified σ2 receptor was reconstituted into lipidic cubic phase (LCP) by mixing with a 10:1 (w:w) mix of monoolein (Hampton Research) with cholesterol (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Na Zhao, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... frozen tumor tissues were crushed to powder and lysed with urea lysis buffer containing 8 M urea (G-Biosciences #BC89), 75 mM NaCl ...
-
No products found
because this supplier's products are not listed.
Ignasi Cos, Giovanni Pezzulo, Paul Cisek,
bioRxiv - Neuroscience 2021
Quote:
... and for each combination of the following three factors: initial choice right or left (ICR/ICL), perturbation direction (PR/PL) ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
... Antibodies were added to each sample (0.5μg of rabbit glucocorticoid receptor antibody [abcam, ab225886, 1:20] or rabbit IgG negative control antibody [Epicypher, 13-0041k, 1:50]). The remaining steps were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Sherine E. Thomas, et al.,
bioRxiv - Biochemistry 2019
Quote:
... Wizard 3&4 (Molecular Dimensions), JCSG +Suite (Molecular Dimensions) ...
-
No products found
because this supplier's products are not listed.
Mingu Kang, et al.,
bioRxiv - Cell Biology 2023
Quote:
... peroxiredoxin-3 (LF-PA0255, Abfrontier), phospho-PKA substrates (9624 ...
-
No products found
because this supplier's products are not listed.
Anne Rosbjerg, et al.,
bioRxiv - Immunology 2024
Quote:
... Affinity Analysis 3 Software (Nanotemper) using a Kd fit model and constraining the target concentration.
-
No products found
because this supplier's products are not listed.
Simon L. April-Monn, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... Total RNA was extracted from fresh frozen tumor tissue or cultured cells with a Single Cell RNA Purification Kit (Norgen Biotek, #51800). Nucleic acid quantification was performed with the Qubit DNA/RNA HS detection kit (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Livia Odagiu, et al.,
bioRxiv - Immunology 2023
Quote:
... The tumor cell suspension was filtered (100µm) and red blood cells were lysed using 0.83% NH4Cl (Bio Basic; CAS #12125-02-9) for 5 min at RT ...
-
No products found
because this supplier's products are not listed.
Cellas A. Hayes, et al.,
bioRxiv - Neuroscience 2021
Quote:
... cells were grown on a T-75 flasks pre-coated with Cell Attachment Factor Solution (123-100, Cell Applications), in 15mL of RBMVEC growth medium (R819-500) ...
-
3',3'-Cyclic GAMP ( cGAMP ) ELISA / Assay Kit
Cat# K073-H1,
1.0 ea, USD $465.0
Ask
Abraham Shim, et al.,
bioRxiv - Genetics 2024
Quote:
... 2′3′-cGAMP levels were quantified using the 2′3′-cGAMP ELISA Kit (Arbor Assays #K067-H5) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Nobunao Ikewaki, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... 3’-diaminobenzidine/H2O2 solution (Nichirei Bioscience Inc., Japan). The primary antibody used was monoclonal antibody to mouse macrophages (BMA Biomedicals ...
-
No products found
because this supplier's products are not listed.
Greg Tram, et al.,
bioRxiv - Microbiology 2019
Quote:
... 3 µm particle size (Tosoh Biosciences, Tokyo, Japan). Samples were resuspended in buffer B (90% MeCN / 0.1% TFA ...
-
No products found
because this supplier's products are not listed.
Pavan Nayak, Arul Subramanian, Thomas Schilling,
bioRxiv - Developmental Biology 2022
Quote:
... using a BeadBug 3 Microtube Homogenizer D1030 (Benchmark Scientific), and RNA was extracted using Trizol according to the standard protocol (Invitrogen 15596018) ...
-
No products found
because this supplier's products are not listed.
Sarah A Fahlberg, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... and 3 μg/mL anti-myc IgY (Aves Labs) conjugated with Alexa488 using NHS chemistry ...
-
Cat# F3,
USD $18.00/EA
Ask
Richard J. Roller, et al.,
bioRxiv - Microbiology 2021
Quote:
... or mouse anti-VP5 (Biodesign. International) 1:500 ...
-
No products found
because this supplier's products are not listed.
Aya M. Saleh, et al.,
bioRxiv - Bioengineering 2021
Quote:
... 5 mM tris(3-hydroxypropyltriazolylmethyl)amine (THPTA; Click Chemistry Tools), 2 mM copper sulfate ...
-
No products found
because this supplier's products are not listed.
Joshua Hutchings, et al.,
bioRxiv - Cell Biology 2020
Quote:
... 3 μL of BSA-blocked 5 nm gold nanoparticles (BBI Solutions) were added to a 30 μL GUV BR and gently agitated just prior to vitrification ...
-
No products found
because this supplier's products are not listed.
Jiajie Xu, Juan J.L. Guzman, Largus T. Angenent,
bioRxiv - Bioengineering 2020
Quote:
... The increased solution volume in chamber #3 was pumped (Cole-Parmer L/S Digital Economy Drive ...
-
No products found
because this supplier's products are not listed.
Xiaodan Zhang, et al.,
bioRxiv - Genomics 2021
Quote:
... anti-mouse Lyve1 antibody (1:100, AngioBio cat.no ...
-
No products found
because this supplier's products are not listed.
Rita R. Fagan, et al.,
bioRxiv - Neuroscience 2020
Quote:
... mouse anti-SERT (ST51-2; Mab Technologies), rabbit anti-HA (C29F4 ...
-
No products found
because this supplier's products are not listed.
Takuma Uo, et al.,
bioRxiv - Cancer Biology 2024
Quote:
Uptake of 3H-3-O-methylglucose (American Radiolabeled Chemicals, St. Louis, MO) and 3H-2-deoxyglucose (Perkin Elmer ...
-
No products found
because this supplier's products are not listed.
Robert N. Plasschaert, et al.,
bioRxiv - Neuroscience 2021
Quote:
RAW264.7 mouse macrophage cells (ATCC; confirmed by STR profiling, IDEXX) were transduced with increasing multiplicity of infections with LVV.GRN or LVV.GBA vector ...
-
No products found
because this supplier's products are not listed.
Jean-Philippe Corre, et al.,
bioRxiv - Pathology 2022
Quote:
... platelets using DyLight488-anti-mouse GPIbβ antibody (0.1 μg, #X488, Emfret Analytics) and fibrin deposits using DyLight488-anti-human/mouse fibrin antibody (8 μg ...
-
No products found
because this supplier's products are not listed.
Rebekka Medert, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... Pools of 2 or 3 E4.5 blastocysts were lysed in 10 μl lysis buffer (DirectPCR buffer, Viagen, supplemented with 2.5 μg/ml Proteinase K ...