-
No products found
because this supplier's products are not listed.
Madeleine F. Jennewein, et al.,
bioRxiv - Immunology 2021
Quote:
To investigate Fc receptor binding recombinant Fc receptors with an AviTag were biotinylated using a Bir500 kit (Avidity, Aurora, CO, USA) according to manufacturer’s instructions and purified using a Zeba Spin Desalting Column ...
-
No products found
because this supplier's products are not listed.
Pasquale Valenzisi, et al.,
bioRxiv - Cell Biology 2024
Quote:
... recombinant anti-S9.6 (rabbit-monoclonal, Kerafast; 1:200), anti-RAD51 (rabbit-polyclonal ...
-
No products found
because this supplier's products are not listed.
Angela M. Bosco-Lauth, et al.,
bioRxiv - Microbiology 2020
Quote:
... Positive control antibodies to the receptor-binding domain (RBD) and full-length spike protein were human MAb CR3022 antibody (Absolute Antibody, Oxford UK) and human IgG whole molecule (Jackson Immuno Research ...
-
No products found
because this supplier's products are not listed.
Wenjun Zhang, et al.,
bioRxiv - Bioengineering 2022
Quote:
... and EpCAM (mAb Progen, Heidelberg ...
-
No products found
because this supplier's products are not listed.
Ebrahim Elsangeedy, et al.,
bioRxiv - Physiology 2024
Quote:
... rabbit anti-peroxisome proliferator-activated receptor gamma (PPARγ; 1:1200 dilution; Biorbyt, LLC, Durham, NC, USA; Cat#: orb11291), rabbit anti-GPER (1:200 dilution ...
-
No products found
because this supplier's products are not listed.
Xiaochun Xie, et al.,
bioRxiv - Neuroscience 2022
Quote:
... mouse TNF-α ELISA kit (E-MSEL-M0002, Elabscience), mouse IL-1α ELISA kit (E-EL-M3059 ...
-
No products found
because this supplier's products are not listed.
Tyler B. Waltz, et al.,
bioRxiv - Neuroscience 2023
Quote:
Recombinant rat protein p11 (S100A10 Recombinant Protein, Aviva Systems Biology, OPCD06771) was dissolved in distilled water to obtain a final concentration of 100ug/mL and stored at -80C for less than one month ...
-
No products found
because this supplier's products are not listed.
Michael J. Robertson, et al.,
bioRxiv - Biophysics 2022
Quote:
All receptors were expressed in Sf9 insect cells (Expression Systems) infected at a density of 3-4 million cells/ml ...
-
No products found
because this supplier's products are not listed.
Yan Li, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or anti-PAC1 receptor (1:50 dilution, LifeSpan BioSciences, Inc.) at 4°C overnight ...
-
No products found
because this supplier's products are not listed.
Timothy F. Shay, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Membrane associated receptor candidates were transfected by polyethylenimine (PolySciences # 23966). Cells were seeded on Neuvitro Poly-D-lysine coated sterile German glass coverslips (Fisher Scientific #NC0343705 ...
-
No products found
because this supplier's products are not listed.
Derek D.C. Ireland, et al.,
bioRxiv - Neuroscience 2020
Quote:
... or mouse anti-ZikV E protein mAb (Fitzgerald, 2713), neurofilament heavy chain cocktail (SMI31 and SMI32 mAb ...
-
Recombinant Rabbit BCMA Protein, fused to His tag, was expressed in HEK293.
Cat# TNFRSF17-02R,
10ug , USD $198
Ask
Noah R. Johnson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... recombinant human apoA-I (Creative Biomart), human plasma-derived apoE (Sigma) ...
-
No products found
because this supplier's products are not listed.
Akiko Doi, et al.,
bioRxiv - Genetics 2022
Quote:
... we mutagenized mab-10(tm2497) mutants with ethyl methanesulfonate (EMS) as described previously71 ...
-
No products found
because this supplier's products are not listed.
Juliane Tschuck, et al.,
bioRxiv - Cell Biology 2023
Quote:
For inhibition of different receptors and proteins we used HX 531 (Biomol) as a pan-Retinoic Acid Receptor (RAR ...
-
No products found
because this supplier's products are not listed.
B. I. M. Wicky, et al.,
bioRxiv - Biophysics 2022
Quote:
... Growth media was TB-II autoinduction media: TB-II (Terrific Broth II, MP biomedicals - prepared according to manufacturer’s specifications ...
-
No products found
because this supplier's products are not listed.
Bhawana Shrestha, et al.,
bioRxiv - Bioengineering 2021
Quote:
Endotoxin levels in mAbs were measured with Endosafe PTS (Charles River), which detects by measuring color-intensity related to endotoxin concentration.
-
No products found
because this supplier's products are not listed.
Lily E. Adams, et al.,
bioRxiv - Microbiology 2022
Quote:
... and 1:750 for Fcγ-receptor binding) in a 384-well plate (Greiner, Germany) overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
C Seth Lott, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Ang II (Phoenix Pharmaceuticals) was infused via subcutaneously implanted osmotic minipump (ALZET model 1007D ...
-
No products found
because this supplier's products are not listed.
Maria Prange-Barczynska, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... then Histo-Clear II (National Diagnostics) and finally wax at 60°C in an automated tissue processor (Excelsior AS ...
-
No products found
because this supplier's products are not listed.
Martineau Éric, et al.,
bioRxiv - Neuroscience 2020
Quote:
... postsynaptic nicotinic receptors (nAChRs) were labeled using α-Bungarotoxin (BTX) conjugated with CF405 (4 μg/mL; Biotium; cat ##00002) for 45 min in PBS ...
-
No products found
because this supplier's products are not listed.
Nuno Apóstolo, et al.,
bioRxiv - Neuroscience 2020
Quote:
... rabbit anti-BRINP2 (Atlas Antibodies), sheep anti-CNTN1 (R&D Systems) ...
-
No products found
because this supplier's products are not listed.
Hajera Amatullah, et al.,
bioRxiv - Immunology 2021
Quote:
... Recombinant Topoisomerase I and II were purchased from Topogen. Nuclear lysates were obtained from control or SP140 knockdown THP-1 cells or primary human peripheral blood-derived macrophages ...
-
No products found
because this supplier's products are not listed.
Alejandro M. Gomez, et al.,
bioRxiv - Immunology 2023
Quote:
... was induced by retro-orbital injection of a cocktail of 5 monoclonal antibodies (mAbs) against mouse collagen type II (anti-CII cocktail, Chondrex Inc), followed by intraperitoneal injection of lipopolysaccharide (LPS ...
-
No products found
because this supplier's products are not listed.
Audrey Caron, et al.,
bioRxiv - Biochemistry 2020
Quote:
... and the TNF-α mouse ELISA kit (Biomatik, EKA51917), respectively ...
-
No products found
because this supplier's products are not listed.
Mohita Tagore, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... or DMH1 (BMP receptor, Sigma #D8946, 0.5 µM) or EC330 (LIF receptor ...
-
No products found
because this supplier's products are not listed.
Joan Kyula-Currie, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... The TNF-a high sensitivity ELISA [BE58351] was sourced from Tecan (IBL).
-
No products found
because this supplier's products are not listed.
Bingbing Yu, Yifan Chen, Yan Yan, Bin Zhu,
bioRxiv - Molecular Biology 2023
Quote:
... and incubated with dsRNA-specific J2 mAb (SCICONS) for 30 min at 25°C ...
-
No products found
Katharina M. Eyme, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... human recombinant EGF (20 ng/mL; ABM), and human recombinant bFGF-2 (10ng/mL ...
-
No products found
because this supplier's products are not listed.
Anil H. Kadam, et al.,
bioRxiv - Bioengineering 2022
Quote:
... recombinant hu TGF-β1(ProSci, Poway, CA), anti-TGF-β1 IgY-Biotin (R&D Systems ...
-
No products found
because this supplier's products are not listed.
Akesh Sinha, et al.,
bioRxiv - Immunology 2024
Quote:
... Biotinylated mAbs were immobilized on streptavidin-coated biosensors (Sartorius, Goettingen, Germany) for 60 seconds at 50 µg/ml concentration ...
-
No products found
because this supplier's products are not listed.
Adam T. Hilterbrand, et al.,
bioRxiv - Microbiology 2021
Quote:
... II (SignaGen Laboratories). In all cases ...
-
No products found
because this supplier's products are not listed.
Bijal A. Parikh, et al.,
bioRxiv - Immunology 2019
Quote:
... Fc receptor blocking was performed with 2.4G2 (anti-FcγRII/III) hybridoma (American Type Culture Collection) culture supernatants ...
-
No products found
because this supplier's products are not listed.
Ioscani Jiménez del Val, et al.,
bioRxiv - Systems Biology 2021
Quote:
... mAb titre was determined using the BLItz® system (Pall ForteBio, Portsmouth, UK). Time profiles for glucose ...
-
No products found
because this supplier's products are not listed.
Rachel A. Jones, et al.,
bioRxiv - Biochemistry 2020
Quote:
... Crystal Screens I and II and Natrix I and II (all from Hampton Research) were used for the initial RNA screen at room temperature in sitting-drop vapor diffusion crystal trays (Axygen) ...
-
No products found
because this supplier's products are not listed.
Kenji Shimada, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... then 0.002 U of recombinant hOGG1 (Trevigen, 4130-100-E) was added to one sample and further incubated for 30 min at 37°C ...
-
No products found
because this supplier's products are not listed.
Masayoshi Sakakura, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and Wizard I & II (Rigaku) with a Protein Crystallization System 2 (PXS2 ...
-
No products found
because this supplier's products are not listed.
Neha Singh, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... Recombinants were imaged on a stereomicroscope equipped with fluorescent imaging (Olympus).
-
No products found
because this supplier's products are not listed.
Yue Han, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Vesicles containing transferrin receptor were imaged using an sCMOS camera through a CFI Apo 60× 1.49 objective (Nikon) on a Ti2 microscope (Nikon) ...
-
No products found
because this supplier's products are not listed.
Harshana Rajakaruna, et al.,
bioRxiv - Immunology 2021
Quote:
... anti-YFP mAbs were used and samples were imaged using a confocal microscope (LSM-710; Carl Zeiss)[46] ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Min Jiang, Changyin Fang, Yongping Ma,
bioRxiv - Immunology 2023
Quote:
... Mouse anti-VSV-tag mAb were purchased from Abbkine Scientific (cat# A02180 ...
-
No products found
because this supplier's products are not listed.
Charles M. Ensor, et al.,
bioRxiv - Physiology 2021
Quote:
... RIA was performed using a rabbit-anti-angiotensin II antiserum (0.3 μg/ml; Peninsula Laboratories Catalog# T-4005) and [125I]AngII (2,175 Ci/mmol ...
-
No products found
because this supplier's products are not listed.
Neuza S. Sousa, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Recombinant human MANF (P-101–100; Icosagen) was used as a standard ...
-
No products found
because this supplier's products are not listed.
Jessica A. Breznik, et al.,
bioRxiv - Immunology 2022
Quote:
... Littermate WT and TNF−/- mice were weaned onto Teklad irradiated global 14% protein diet (cat#2914, Envigo). To assess effects of diet-induced obesity ...
-
No products found
because this supplier's products are not listed.
Diana N. Medina-Pérez, et al.,
bioRxiv - Microbiology 2020
Quote:
... B burgdorferi strains were grown in BSK-II media supplemented with 6% normal rabbit serum (Pel-Freez Biologicals, Rogers, AR) under conventional microaerobic conditions at 32°C ...
-
No products found
because this supplier's products are not listed.
Tony Ngo, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... and 1.0 μg/well of the indicated receptors using TransIT-X2 transfection reagent (Mirus Bio); the total transfected DNA was normalized to 3.0 μg/well for all wells using empty pcDNA3.1 ...
-
No products found
because this supplier's products are not listed.
Rory Henderson, et al.,
bioRxiv - Immunology 2023
Quote:
... The synthetic Toll-like receptor 7/8 agonist 3M-052 absorbed to ALUM (3M-052-ALUM) was used as the adjuvant for the vaccine immunogens ...
-
No products found
because this supplier's products are not listed.
Klara Filek, et al.,
bioRxiv - Microbiology 2022
Quote:
... PECS II (Gatan Inc., Pleasanton, CA, USA). The specimens were analysed with JEOL JSM-7800F scanning electron microscope (JEOL ...
-
No products found
because this supplier's products are not listed.
Marco De Giorgi, et al.,
bioRxiv - Genetics 2023
Quote:
... rabbit anti Ki67 (1:60, CRM325, Biocare); rabbit anti FAH (1:65 ...
-
No products found
because this supplier's products are not listed.
Leonid Andronov, et al.,
bioRxiv - Biophysics 2021
Quote:
... Rabbit anti-GFP (TP-401, Torrey Pines Biolabs); Chicken anti-GFP (GFP-1010 ...