-
No products found
because this supplier's products are not listed.
Cathal Meehan, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Recombinant IL-6 with an N-terminal his tag (Fitzgerald, Biosynth Ltd.) was immobilized on His-Pur™ Ni-NTA Resin (ThermoScientific ...
-
No products found
because this supplier's products are not listed.
Megan N. Thomas, et al.,
bioRxiv - Microbiology 2023
Quote:
Serum samples collected from the indirect contact pigs at 11 DPC were prepared for the hemagglutination inhibition (HI) assay by receptor-destroying enzyme (RDE II; Hardy Diagnostics, Santa Maria, CA) treatment ...
-
No products found
because this supplier's products are not listed.
Alan Dogan, Katherine Dabkowski, Horst von Recum,
bioRxiv - Bioengineering 2020
Quote:
... IL-10 ELISA Kit (Interleukin 10) was purchased from Antibodies-online.com (Limerick ...
-
No products found
because this supplier's products are not listed.
Luisa Diomede, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... FLAG-tagged ACE2 (AdipoGen) was captured on the chip by a previously immobilized anti-FLAG antibody (Merck Life Science S.r.l) ...
-
Recombinant Interleukin 7 Receptor (IL7R) is a recombinant Human protein produced in E. coli...
Cat# abx067551-10UG,
10 µg USD $275.5
Ask
Isabel Brandão, et al.,
bioRxiv - Physiology 2023
Quote:
... or after the primary antibody was incubated with recombinant Human Peroxidasin Homolog Protein (Abbexa; catalog # abx068474), in equimolar (1:1 ...
-
7-Dehydrocholesterol (7-DHC, Provitamin D3) is the direct precursor of free cholesterol in the...
Cat# S5386, SKU# S5386-25mg,
25mg, $107.00
Ask
Richard Kanyo, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... Receptor inhibitors AM251 (Selleck Chemicals, Houston, TX, USA) and AM630 (Adooq Bioscience ...
-
No products found
because this supplier's products are not listed.
Nanami Sakata, et al.,
bioRxiv - Plant Biology 2022
Quote:
... L-His (Tokyo Chemical Industry), and L-Lys (Nacalai tesque ...
-
No products found
because this supplier's products are not listed.
Tyler B. Waltz, et al.,
bioRxiv - Neuroscience 2023
Quote:
Recombinant rat protein p11 (S100A10 Recombinant Protein, Aviva Systems Biology, OPCD06771) was dissolved in distilled water to obtain a final concentration of 100ug/mL and stored at -80C for less than one month ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... His-tag antibody (Tiangen, Beijing, China) and GST antibody (Tiangen).
-
No products found
because this supplier's products are not listed.
Siran Zhu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
No products found
because this supplier's products are not listed.
Erin A. Akins, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Microglia were polarized to M2 with 50 ng/ml interleukin-4 (IL-4, Bio Basic, RC212-15-5) for 48 hours.
-
No products found
because this supplier's products are not listed.
Su Z. Hong, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Viral injection of the recombinant adeno-associated virus expressing Cre recombinase under the control of human synapsin promoter (rAAV-hSyn-Cre; from SignaGen Laboratories, Rockville, MD) was done by bulk regional viral injection to the visual cortical area of neonatal Cre dependent Gs-DREADD mice at p1 ...
-
No products found
because this supplier's products are not listed.
Xinquan Liu, Debadyuti Ghosh,
bioRxiv - Bioengineering 2019
Quote:
... and Cyanine 7 (Cy7, Lumiprobe) was conjugated to monomeric BSA according to manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Logan T. Blancett, et al.,
bioRxiv - Microbiology 2023
Quote:
... Fc receptors were blocked for 10 minutes with CD32/CD16 mAb (Leinco Technologies, Inc.). Cells were incubated with Zombie UV™ Fixable Viability Dye (BioLegend ...
-
No products found
because this supplier's products are not listed.
Christiane Geithe, et al.,
bioRxiv - Biochemistry 2021
Quote:
We used hybriwell chambers (16 wells, 7 mm x 7 mm x 0.05 mm; RD477991, Grace Bio-Labs, Oregon, USA) that were customized according to our needs ...
-
No products found
because this supplier's products are not listed.
Andrew J. Stout, et al.,
bioRxiv - Bioengineering 2022
Quote:
... or Beefy-R (Hi-Def B8 supplemented with 0.4 mg/mL RPI). Beefy-9 and Beefy-R were prepared immediately before use ...
-
No products found
because this supplier's products are not listed.
Luana dos Santos Ortolan, et al.,
bioRxiv - Pathology 2019
Quote:
Soluble endothelial protein C receptor (sEPCR) was measured with an ELISA kit (Elabscience®, E-EL-M1073) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Huan Ma, et al.,
bioRxiv - Immunology 2022
Quote:
... The recombinant vectors were transiently transfected into HEK293F cells with polyethyleneimine (Polyscience). After three days of expression ...
-
No products found
because this supplier's products are not listed.
Diego Gilioli, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... 10% Human Serum (cat#ECS0219D from Euroclone) and IL-2 (cat#F027131010 from Novartis ...
-
No products found
because this supplier's products are not listed.
Maciej Kliszczak, et al.,
bioRxiv - Cell Biology 2023
Quote:
... rabbit anti-human FAM111B (HPA038637, Atlas Antibodies) at 1:1000 (IB and IF) ...
-
No products found
because this supplier's products are not listed.
Nicholas B. Karabin, et al.,
bioRxiv - Bioengineering 2020
Quote:
... Pooled human plasma was acquired from Zen-Bio Inc ...
-
No products found
because this supplier's products are not listed.
Lars Gruber, et al.,
bioRxiv - Biochemistry 2023
Quote:
Monoculture and biculture spheroids of CCD-1137Sk human fibroblasts and HT-29 human colon cancer cells (both LGC Standards, Wesel, Germany) were prepared ...
-
No products found
because this supplier's products are not listed.
Nadine R King, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 2 mg/ml Human Serum Albumin (HSA; Irvine Scientific), 10 μg/ml insulin (Sigma) ...
-
No products found
because this supplier's products are not listed.
MEENAKSHI TETORYA, et al.,
bioRxiv - Plant Biology 2023
Quote:
... The His-tagged peptides (GMA4CG_WT and GMA4CG_V6) phospholipid binding assays were performed using the PIP StripsTM (Echelon Biosciences Inc., CA) as previously described (Islam et al. ...
-
No products found
because this supplier's products are not listed.
Hanyuan Shen, et al.,
bioRxiv - Pharmacology and Toxicology 2019
Quote:
A431 cells were treated with different injections for 48 hours in 96-well plates and the cell culture supernatant was collected and tested for the level of IL-1β by ELISA using human interleukin-1 beta ELISA kit (Biosensis, CA, USA) according to the kit protocol ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
KDM5A inhibitor
Sold for research purposes only.
Cat# 2674.0, SKU# 2674-5 mg,
5mg, US $137.50 / EA, EURO, €125 / EA
Ask
Daniel J. Steinberg, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 2.5µg/ml human recombinant Insulin (Biological Industries; 41-975-100) and 3µM CHIR-99021 (Axon Medchem ; 1386) sterilized through 0.22μm filter ...
-
No products found
because this supplier's products are not listed.
Peter Hanna, et al.,
bioRxiv - Neuroscience 2020
Quote:
... A quadripolar His catheter (Abbott) was placed via the right external jugular vein and advanced until a His signal was visualized while a quadripolar catheter was inserted via the right femoral vein and advanced to the right atrium ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Ana Lucia Rosales Rosas, et al.,
bioRxiv - Molecular Biology 2022
Quote:
7-Deaza-2’-C-Methyladenosine (7-DMA) was purchased from Carbosynth (Berkshire, UK) and dissolved in DMSO ...
-
No products found
because this supplier's products are not listed.
C. Fung, et al.,
bioRxiv - Neuroscience 2021
Quote:
... GLP-1 (7-36)-amide (Phoenix Pharmaceuticals), CCK-8 (PolyPeptides Laboratories) ...
-
No products found
because this supplier's products are not listed.
Connor D. Courtney, et al.,
bioRxiv - Neuroscience 2021
Quote:
... and QCapture Pro 7 software (Teledyne Photometrics).
-
No products found
because this supplier's products are not listed.
Julia A Alvarez, et al.,
bioRxiv - Microbiology 2024
Quote:
... 20% heat inactivated (HI) fetal bovine serum (FBS) (Omega Scientific), 1% penicillin-streptomycin (Life Technologies ...
-
No products found
because this supplier's products are not listed.
Jan-Renier A.J. Moonen, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Flag-tagged KLF4 (#VH829440, Vigene Biosciences) or GFP control (AVP004, GenTarget Inc) for 12 h after which cells were allowed to recover for 90 h before being harvested for subsequent experiments.
-
No products found
because this supplier's products are not listed.
William S. Lawrence, et al.,
bioRxiv - Microbiology 2023
Quote:
... Biotinylated recombinant PA83 (List Biological Labs, Campbell, CA) was bound to streptavidin-coated plates (MesoScale Discovery ...
-
No products found
because this supplier's products are not listed.
Xiaoning Yang, et al.,
bioRxiv - Immunology 2023
Quote:
... C1q recombinant protein (A400) was purchased from Quidel and its secondary anti C1q/HRP (ab46191 ...
-
No products found
because this supplier's products are not listed.
Najet Serradj, et al.,
bioRxiv - Neuroscience 2022
Quote:
... The double layer of dorsal musculature was closed with 7-0 vicryl absorbable surgical suture (Ethicon) and skin closed with 7 mm surgical wound clips (Fine Science Tools). Mice were given 1 ml saline (0.9% solution ...
-
CDH18 is expressed specifically in the central nervous system and is putatively involved in...
Cat# 5090-0.1MG,
0.1 mg, USD $235.0
Ask
Ines A Cadena, et al.,
bioRxiv - Bioengineering 2022
Quote:
... and gelatin methacryloyl (GelMA, 7% w/v, Advanced BioMatrix) were crosslinked using the UV photo crosslinker irgacure 2959 for 1 minute under a 365 nm UV light crosslinking source according to protocols specified by the manufacturer ...
-
No products found
because this supplier's products are not listed.
Michael S. Balzer, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... and 10 U/ml recombinant mouse interferon-□ (Cell Sciences, Canton, MA) at 33 °C (permissive conditions ...
-
No products found
because this supplier's products are not listed.
Shahzad S. Khan, et al.,
bioRxiv - Cell Biology 2021
Quote:
... the other group (7 mice) received untreated diet (Research Diets D01060501) for 14 days and served as the control group ...
-
No products found
because this supplier's products are not listed.
Mason A. McCool, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... Swollen cells were dounced using a 7 mL dounce (Wheaton, 3575420) for 20 strokes ...
-
No products found
because this supplier's products are not listed.
Saurabh Srivastava, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The optimal receptor-binding domain (OBD) (100, 100) of Tetanus Toxin (Heavy Chain/B Subunit) was synthesized by GENEWIZ (incorporating flanking 5’ Hindlll and 3’ Nco1 restriction sites ...
-
No products found
because this supplier's products are not listed.
Balaji Karthick Subramanian, et al.,
bioRxiv - Pathology 2019
Quote:
... Human primary podocytes from Celprogen Inc ...
-
No products found
because this supplier's products are not listed.
Jothi K. Yuvaraj, et al.,
bioRxiv - Neuroscience 2020
Quote:
... after which cells were investigated for ligand-induced receptor activation using a FLUOstar Omega plate reader (BMG Labtech, Ortenberg, Germany). Cells were tested in triplicates (technical replicates ...
-
No products found
because this supplier's products are not listed.
Ben Jin, et al.,
bioRxiv - Biochemistry 2023
Quote:
... supplied with 7 ml of Dulbecco’s Modified Eagle’s Medium (Genesee, #25-500) containing 10% fetal bovine serum ...
-
No products found
because this supplier's products are not listed.
Daniel Schindler, et al.,
bioRxiv - Synthetic Biology 2022
Quote:
... The DNA Hi-C libraries were sheared into 300 bp using a Covaris S220 apparatus (Covaris) and the biotin-labeled fragments were selectively captured by Dynabeads Myone Streptavidin C1 ...
-
No products found
because this supplier's products are not listed.
Joseph Deering, et al.,
bioRxiv - Bioengineering 2023
Quote:
... and pixel size of 7 nm on a Continuum S imaging filter (Gatan). EELS elemental maps for carbon ...
-
No products found
Amy R. Strom, et al.,
bioRxiv - Biophysics 2020
Quote:
... was added to HP1α-AID-sfGFP cells expressing an miRFP-tagged histone H2B plated in 96-well glass bottom plates (Cellvis). 25 X-Y points were chosen in each of the control and experimental wells ...
-
No products found
because this supplier's products are not listed.
Xiangyu Zhou, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... succinyl-Leu-Leu-Val-Tyr-7-amino-4-methylcoumarin (Suc-LLVY-MCA; Peptide Institute, Cat#3120-v) in 100 mM Tris-HCl (pH 8.0 ...
-
No products found
because this supplier's products are not listed.
Qinghui Wang, et al.,
bioRxiv - Immunology 2022
Quote:
... Naïve CD3 human T cells were purchased from HemaCare (Lot #21068415). N/TERT-1 cells were a gift from the Rheinwald Lab (Dickson et al. ...