-
No products found
because this supplier's products are not listed.
Pia Hempelmann, et al.,
bioRxiv - Cell Biology 2023
Quote:
... His-tagged protein was captured using NiNTA agarose beads (Cube Biotech) and eluted in 10 x 1 mL fractions with elution buffer containing 250 mM imidazole ...
-
No products found
because this supplier's products are not listed.
Kyle T. Shuler, et al.,
bioRxiv - Physiology 2020
Quote:
... 5 ng/ml basic-fibroblast growth factor (Progen, Heidleberg, Germany), and equal parts DMEM and Ham’s F10 mix ...
-
No products found
because this supplier's products are not listed.
Nicole J. Yang, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Lethal factor (LF) was purchased from List Biological Laboratories (#169, recombinant from B. anthracis). Protective antigen (PA ...
-
No products found
because this supplier's products are not listed.
Shaun M. Christie, et al.,
bioRxiv - Biophysics 2021
Quote:
... Recombinant human Semaphorin 3A (CX65, Bon Opus Biosciences, Milburn, NJ) contains residues 21-771 and is >95% pure ...
-
No products found
because this supplier's products are not listed.
Marisa Oliveira, et al.,
bioRxiv - Immunology 2020
Quote:
... P/S and 25 ng/ml recombinant chicken colony stimulating factor 1 (CSF-1) (Kingfisher Biotech, Inc) at 41 °C and 5% CO2 ...
-
No products found
because this supplier's products are not listed.
Luisa Diomede, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... FLAG-tagged ACE2 (AdipoGen) was captured on the chip by a previously immobilized anti-FLAG antibody (Merck Life Science S.r.l) ...
-
Epidermal Growth Factor, His Protein is a recombinant cytokine.
Cat# abx263234-2UG,
2 µg USD $261.0
Ask
Isabel Brandão, et al.,
bioRxiv - Physiology 2023
Quote:
... or after the primary antibody was incubated with recombinant Human Peroxidasin Homolog Protein (Abbexa; catalog # abx068474), in equimolar (1:1 ...
-
No products found
because this supplier's products are not listed.
Vincent Soubannier, et al.,
bioRxiv - Neuroscience 2019
Quote:
... human iPSC-derived astrocytes were incubated with tumour necrosis factor alpha (TNFa) (30 ng/ml; Cell Sciences; Newburyport, MA; Cat. No. CRT100B), interleukin alpha (IL-1a ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... His-tag antibody (Tiangen, Beijing, China) and GST antibody (Tiangen).
-
No products found
because this supplier's products are not listed.
Siran Zhu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
No products found
because this supplier's products are not listed.
Su Z. Hong, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Viral injection of the recombinant adeno-associated virus expressing Cre recombinase under the control of human synapsin promoter (rAAV-hSyn-Cre; from SignaGen Laboratories, Rockville, MD) was done by bulk regional viral injection to the visual cortical area of neonatal Cre dependent Gs-DREADD mice at p1 ...
-
No products found
because this supplier's products are not listed.
Dennis J. Doorduijn, et al.,
bioRxiv - Microbiology 2021
Quote:
... Cobra venom factor (CVF) was obtained from Quidel. Preassembled C5b6 ...
-
No products found
because this supplier's products are not listed.
Logan T. Blancett, et al.,
bioRxiv - Microbiology 2023
Quote:
... Fc receptors were blocked for 10 minutes with CD32/CD16 mAb (Leinco Technologies, Inc.). Cells were incubated with Zombie UV™ Fixable Viability Dye (BioLegend ...
-
No products found
because this supplier's products are not listed.
Gabriele Flossmann, et al.,
bioRxiv - Genomics 2020
Quote:
... Library preparation followed ultrasonic fragmentation (Covaris: 50 s, 5% duty factor) using the Illumina TruSeq DNA PCR-Free Sample Preparation Kit with an insert size of 350 bp ...
-
No products found
because this supplier's products are not listed.
Sylvie Roy, et al.,
bioRxiv - Microbiology 2020
Quote:
... Serial dilutions of known amounts of C-terminally Fc-tagged S2 (BioVendor, Brno, Czech Republic) were used for quantification.
-
No products found
because this supplier's products are not listed.
Azaz Ahmed, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... and cultured in complete growth medium with serum (Celprogen, USA; M35002-04S). Medium was changed every 24 hours ...
-
No products found
because this supplier's products are not listed.
Saurabh Srivastava, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The optimal receptor-binding domain (OBD) (100, 100) of Tetanus Toxin (Heavy Chain/B Subunit) was synthesized by GENEWIZ (incorporating flanking 5’ Hindlll and 3’ Nco1 restriction sites ...
-
No products found
because this supplier's products are not listed.
Elise Tookmanian, et al.,
bioRxiv - Microbiology 2021
Quote:
The growth curve assays were performed in 96 well tissue culture plates (Genesee Scientific) using a Spark 10M multimode microplate reader (Tecan ...
-
No products found
Amy R. Strom, et al.,
bioRxiv - Biophysics 2020
Quote:
... was added to HP1α-AID-sfGFP cells expressing an miRFP-tagged histone H2B plated in 96-well glass bottom plates (Cellvis). 25 X-Y points were chosen in each of the control and experimental wells ...
-
No products found
because this supplier's products are not listed.
Maciej Kliszczak, et al.,
bioRxiv - Cell Biology 2023
Quote:
... rabbit anti-human FAM111B (HPA038637, Atlas Antibodies) at 1:1000 (IB and IF) ...
-
No products found
because this supplier's products are not listed.
Tuya Nanzadsuren, et al.,
bioRxiv - Evolutionary Biology 2021
Quote:
... The melatonin and epidermal growth factor (EGF) levels were measured using a semi-automated enzyme-linked immunosorbent assay analyzer (Dynex Technologies DS2®; DRG International, Germany) [17] ...
-
No products found
because this supplier's products are not listed.
Cathal Meehan, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Recombinant IL-6 with an N-terminal his tag (Fitzgerald, Biosynth Ltd.) was immobilized on His-Pur™ Ni-NTA Resin (ThermoScientific ...
-
No products found
because this supplier's products are not listed.
MEENAKSHI TETORYA, et al.,
bioRxiv - Plant Biology 2023
Quote:
... The His-tagged peptides (GMA4CG_WT and GMA4CG_V6) phospholipid binding assays were performed using the PIP StripsTM (Echelon Biosciences Inc., CA) as previously described (Islam et al. ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Peter Hanna, et al.,
bioRxiv - Neuroscience 2020
Quote:
... A quadripolar His catheter (Abbott) was placed via the right external jugular vein and advanced until a His signal was visualized while a quadripolar catheter was inserted via the right femoral vein and advanced to the right atrium ...
-
No products found
because this supplier's products are not listed.
Nanami Sakata, et al.,
bioRxiv - Plant Biology 2022
Quote:
... L-His (Tokyo Chemical Industry), and L-Lys (Nacalai tesque ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Bryan J. González, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and 2 µM R428 (Tyrosine kinase receptor AXL inhibitor) (ApexBio, A8329). From d1 to d11 media was changed every day and from d12 to d27 media was changed every other day ...
-
No products found
because this supplier's products are not listed.
Maxime De Rudder, et al.,
bioRxiv - Cell Biology 2024
Quote:
... Factor V serum protein concentration was assessed by ELISA following manufacturer’s instructions (Mouse factor V ELISA kit orb409284, Biorbyt).
-
No products found
because this supplier's products are not listed.
Liangbo Qi, et al.,
bioRxiv - Biophysics 2019
Quote:
... 3.5 μl aliquots of the recombinant human TIM22 complex (7 mg ml-1) were dropped onto glow discharged holey carbon grids (Quantifoil Au R1.2/1.3, 300 mesh), blotted with a Vitrobot Mark IV (ThemoFisher Scientific ...
-
No products found
because this supplier's products are not listed.
Kiryu K. Yap, et al.,
bioRxiv - Cell Biology 2023
Quote:
Human coagulation factor VIII levels in the mouse plasma were measured using a factor VIII enzyme-linked immunosorbent assay (ELISA) kit (Affinity Biologicals), following manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Bhaskar Saha, et al.,
bioRxiv - Cell Biology 2023
Quote:
... All GST-tagged proteins were expressed in Escherichia coli SoluBL21 (Genlantis). GST fusion proteins were purified on glutathione-Sepharose 4 Fast Flow beads (GE Healthcare 17-5132-01) ...
-
No products found
because this supplier's products are not listed.
Julia A Alvarez, et al.,
bioRxiv - Microbiology 2024
Quote:
... 20% heat inactivated (HI) fetal bovine serum (FBS) (Omega Scientific), 1% penicillin-streptomycin (Life Technologies ...
-
No products found
because this supplier's products are not listed.
Marcus Deichmann, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... a Jurkat cell line equipped with a nuclear factor of activated T cell (NFAT) transcription factor luciferase reporter system (Jurkat NFAT-Luc) (Nordic BioSite, Cat.#BPS-60621) was further modified by insertion of an anti-CD19 CAR (FMC63-CD8ɑ-4-1BB-CD3ζ ...
-
No products found
because this supplier's products are not listed.
Jan-Renier A.J. Moonen, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Flag-tagged KLF4 (#VH829440, Vigene Biosciences) or GFP control (AVP004, GenTarget Inc) for 12 h after which cells were allowed to recover for 90 h before being harvested for subsequent experiments.
-
No products found
because this supplier's products are not listed.
Pooja Sharma, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... containing 10% fetalgro bovine growth serum (RMBIO, Missoula, MT), and 100 units/ml penicillin-100 μg/ml streptomycin (GE Healthcare ...
-
No products found
because this supplier's products are not listed.
Sinan Tetikoğlu, Ugur Uzuner, Selcen Çelik Uzuner,
bioRxiv - Molecular Biology 2024
Quote:
... and gr is the growth rate (AAT Bioquest, 2020).
-
No products found
because this supplier's products are not listed.
Kari H. Ecklund, et al.,
bioRxiv - Cell Biology 2021
Quote:
Anti-His-coated 0.44 μm microbeads (PSS4; Spherotech; prepared as described previously72) were incubated with purified 6His-GFP-3HA-GST-dynein331-HALO in dynein trapping buffer (30 mM HEPES pH 7.2 ...
-
No products found
because this supplier's products are not listed.
Adam F. Odell, et al.,
bioRxiv - Cell Biology 2022
Quote:
... were seeded to fibronectin (Sigma)-coated E-plates (growth) or CIM plates (migration) (ACEA Biosciences, Inc.) and analysed using xCELLigence RTCA DP instrument ...
-
No products found
because this supplier's products are not listed.
Iromi Wanigasuriya, et al.,
bioRxiv - Genomics 2022
Quote:
... The 3’ end of each oligonucleotide probe was fluorescently tagged using Quasar dyes (Biosearch technologies). Bl6-specific oligos were labelled with Quasar 570 and Cast-specific oligos labelled with Quasar 670 ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
Wiktoria Ogrodzińska, et al.,
bioRxiv - Biochemistry 2024
Quote:
... The recombinant plasmids were isolated using plasmid purification kit (Bio Basic Canada) and the inserts were verified by sequencing (Genomed ...
-
No products found
because this supplier's products are not listed.
Nicolas Lamassiaude, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
... Recombinant constructs were purified using EZNA Plasmid DNA Mini kit (Omega Bio-Tek) and sequence-checked (Eurofins Genomics) ...
-
No products found
because this supplier's products are not listed.
Huoming Zhang, et al.,
bioRxiv - Plant Biology 2019
Quote:
... cells were grown in a growth chamber (Innova® 43, New Brunswick Scientific Co., NJ) with shaking at 120 rpm ...
-
No products found
because this supplier's products are not listed.
Aruna Pal, Abantika Pal, Pradyumna Baviskar,
bioRxiv - Genomics 2020
Quote:
... Gene fragment insert in the recombinant plasmid was sequenced by an automated sequencer (ABI prism) using the dideoxy chain termination method with T7 and SP6 primers (Chromous Biotech ...
-
No products found
because this supplier's products are not listed.
Tobias Tertel, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 12 nM anti-human CD63 PE (EXBIO) or 13 nM anti-human CD81 PE (Beckman Coulter) ...
-
No products found
because this supplier's products are not listed.
Yuichi Mitsui, et al.,
bioRxiv - Immunology 2022
Quote:
Human PBMCs were purchased from Precision for Medicine, Inc ...
-
No products found
because this supplier's products are not listed.
John A. Frank, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... coated plates in MTESR+ (Stemcell, 05825) growth-media and sub-cultured using Accutase (Innovative Cell Technologies, AT-104) and MTESR+ supplemented with CloneR (Stemcell ...
-
No products found
because this supplier's products are not listed.
JM Robinson, et al.,
bioRxiv - Immunology 2019
Quote:
... I-FABP (Human I-FABP ELISA Kit, Hycult biotech, Cat# HK406), and LBP (Human Lipopolysaccharide Binding Protein ELISA Kit ...
-
No products found
because this supplier's products are not listed.
Qinghui Wang, et al.,
bioRxiv - Immunology 2022
Quote:
... Naïve CD3 human T cells were purchased from HemaCare (Lot #21068415). N/TERT-1 cells were a gift from the Rheinwald Lab (Dickson et al. ...