-
No products found
because this supplier's products are not listed.
Cathal Meehan, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Recombinant IL-6 with an N-terminal his tag (Fitzgerald, Biosynth Ltd.) was immobilized on His-Pur™ Ni-NTA Resin (ThermoScientific ...
-
No products found
because this supplier's products are not listed.
Nanditha Anandakrishnan, et al.,
bioRxiv - Bioengineering 2020
Quote:
... RFP-tagged human umbilical vein endothelial cells (RFP-HUVECs, Angio-proteomie) were cultured in endothelial cell growth medium (EGM-2 ...
-
No products found
because this supplier's products are not listed.
Pingdewinde N. Sam, et al.,
bioRxiv - Cell Biology 2020
Quote:
... except that human recombinant Usp2Core (LifeSensors Inc., Malvern, PA) was used ...
-
No products found
because this supplier's products are not listed.
MEENAKSHI TETORYA, et al.,
bioRxiv - Plant Biology 2023
Quote:
... The His-tagged peptides (GMA4CG_WT and GMA4CG_V6) phospholipid binding assays were performed using the PIP StripsTM (Echelon Biosciences Inc., CA) as previously described (Islam et al. ...
-
C5a Anaphylatoxin Chemotactic Receptor 1 (CD88) Antibody is a Rat Monoclonal antibody against...
Cat# abx414205-100UG,
100 µg USD $391.5
Ask
Isabel Brandão, et al.,
bioRxiv - Physiology 2023
Quote:
... or after the primary antibody was incubated with recombinant Human Peroxidasin Homolog Protein (Abbexa; catalog # abx068474), in equimolar (1:1 ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Amani A. Hariri, et al.,
bioRxiv - Biophysics 2021
Quote:
... Custom imaging chamber components were purchased from Grace Bio-Labs. Coverslips were purchased from Thermo Fisher Scientific ...
-
K+ channel opener
Sold for research purposes only.
Cat# 1313.0, SKU# 1313-50 mg,
50mg, US $165.00 / EA, EURO, €150 / EA
Ask
Daniel J. Steinberg, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 2.5µg/ml human recombinant Insulin (Biological Industries; 41-975-100) and 3µM CHIR-99021 (Axon Medchem ; 1386) sterilized through 0.22μm filter ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and probed for expression of total MOR (rabbit anti-mu opioid receptor, Neuromics, RA10104, 1:500), P-ser375 MOR (rabbit anti-mu opioid receptor Ser375 ...
-
No products found
because this supplier's products are not listed.
Tingting Zhao, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... YPRaf medium uses YP medium components supplemented with raffinose (2% w/v, Amresco) and antimycin A (1 mg/ml ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Drake M. Mellott, et al.,
bioRxiv - Biochemistry 2020
Quote:
... Recombinant proteases were obtained from the following vendors: human cathepsin L (Millipore Sigma, Athens Research and Technology, Inc., (Texas A&M) or R&D Systems (UCSD) ...
-
No products found
because this supplier's products are not listed.
Thomas S. Lisse,
bioRxiv - Cancer Biology 2020
Quote:
... The vitamin D receptor antagonist ZK159222 (VAZ, Toronto Research Chemicals) was reconstituted in ethanol and kept at −80°C (Ochiai E et al ...
-
No products found
because this supplier's products are not listed.
Christian Franke, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Immunostaining of specific receptors was performed by incubating cells overnight with AlexaFluor 647 conjugated primary antibodies (human CD4: OKT4, dilution: 1:100, source: Biolegend; human CD45: MEM-28, dilution: 1:2000, source: ExBio) diluted in Blocking solution ...
-
No products found
because this supplier's products are not listed.
Bryan J. González, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and 2 µM R428 (Tyrosine kinase receptor AXL inhibitor) (ApexBio, A8329). From d1 to d11 media was changed every day and from d12 to d27 media was changed every other day ...
-
No products found
because this supplier's products are not listed.
Vaibhav Sidarala, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Anti-human TFAM (1:1000, PhosphoSolutions, Catalog# 1999-hTFAM), Anti-mouse TFAM (1:1000 ...
-
No products found
because this supplier's products are not listed.
C. Maresca, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 50 units of purified human PARP-1 (High Specific Activity hPARP-1, Trevigen) were incubated in a mixture containing 100 mM Tris-HCl pH 8 ...
-
No products found
because this supplier's products are not listed.
Luisa Santus, et al.,
bioRxiv - Genomics 2022
Quote:
... we removed duplicates from the samples tagged with UMIs (Zyagen) (Supplemental Table S1 ...
-
No products found
because this supplier's products are not listed.
Ana Boavida, et al.,
bioRxiv - Molecular Biology 2022
Quote:
pCSII-EF-MCS- plasmids expressing Flag-tagged FANCJ WT and AALA mutant were transfected into HEK 293T (shown in Figure 1C and 5A) or FANCJ-KO HeLa cells (shown in Figure 7B) using poly-ethylenimine (PEI, Polyscience, Inc.). At 48 hr post-transfection ...
-
No products found
because this supplier's products are not listed.
Natalie Koh, et al.,
bioRxiv - Neuroscience 2023
Quote:
... was subsequently inserted to a depth of 1.5 mm into the brain (Extended Data Fig. 5a) at a rate of 3-5 μm/s using a motorized micromanipulator (MP-225A, Sutter Instrument). Electrode voltages were acquired at 30 kHz and bandpass filtered at 0.3 to 10 kHz using SpikeGLX (Bill Karsh ...
-
No products found
because this supplier's products are not listed.
William S. Lawrence, et al.,
bioRxiv - Microbiology 2023
Quote:
... Biotinylated recombinant PA83 (List Biological Labs, Campbell, CA) was bound to streptavidin-coated plates (MesoScale Discovery ...
-
No products found
because this supplier's products are not listed.
Ling Li, et al.,
bioRxiv - Immunology 2023
Quote:
... HRP–conjugated goat anti-human antibodies (Zen-bio, 550004; 1:5000 dilution) were added to the wells and incubated at 37°C for 1hr ...
-
No products found
because this supplier's products are not listed.
Ben S. Ou, et al.,
bioRxiv - Bioengineering 2023
Quote:
... HIS Lite Cy3 Bis NTA-Ni Complex was purchased from AAT Bioquest. Unless otherwise stated ...
-
No products found
because this supplier's products are not listed.
Eike K. Mahlandt, et al.,
bioRxiv - Cell Biology 2021
Quote:
... BOECs were stimulated with 1 U/ml human α-thrombin (HCT-0020, Haematologic technologies) diluted in phosphate-buffered saline.
-
No products found
because this supplier's products are not listed.
Surbhi Verma, et al.,
bioRxiv - Microbiology 2023
Quote:
... Human MDMs (hMDMs) were isolated from human PBMCs and separated from healthy human donors’ blood using PolymorphPrep (PROGEN,1895) layering and centrifugation ...
-
No products found
because this supplier's products are not listed.
Iromi Wanigasuriya, et al.,
bioRxiv - Genomics 2022
Quote:
... The 3’ end of each oligonucleotide probe was fluorescently tagged using Quasar dyes (Biosearch technologies). Bl6-specific oligos were labelled with Quasar 570 and Cast-specific oligos labelled with Quasar 670 ...
-
No products found
because this supplier's products are not listed.
Joelle P. Straehla, et al.,
bioRxiv - Bioengineering 2021
Quote:
Human iPS-ECs (Fujifilm Cellular Dynamics, 11713), human brain PCs and ACs (ScienCell) ...
-
No products found
because this supplier's products are not listed.
Diego Gilioli, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... 10% Human Serum (cat#ECS0219D from Euroclone) and IL-2 (cat#F027131010 from Novartis ...
-
No products found
because this supplier's products are not listed.
Katharina Hohenwallner, et al.,
bioRxiv - Biochemistry 2022
Quote:
... 2.5% human platelet lysate, and 1 IU/ml heparin (both PL BioScience, Aachen, Germany) on standard T-flasks (Sarstedt, Nümbrecht, Germany), in a humidified incubator at 37°C and 5% CO2 ...
-
No products found
because this supplier's products are not listed.
Lindsey A. Smith, et al.,
bioRxiv - Neuroscience 2021
Quote:
... TgF344-AD males harboring the amyloid precursor protein Swedish (APPswe) and delta exon 9 mutant human presenilin-1 (PS1∆E9) transgenes were bred to wildtype (Wt) F344 females (Envigo, Indianapolis, IN), as done previously in our lab (Smith and McMahon ...
-
No products found
because this supplier's products are not listed.
Linyi Zhu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... Human trapezial cartilage was ground to a powder using Cryo-Cup Grinder (Biospec, Bartlesville) and then RNA was extracted using Qiagen RNeasy Micro Kit.
-
No products found
because this supplier's products are not listed.
Alaullah Sheikh, et al.,
bioRxiv - Microbiology 2022
Quote:
... in vitro grown differentiated polarized monolayers of human ileal enteroid samples as well as mouse intestinal biopsy samples were fixed in 2% paraformaldehyde/2.5% glutaraldehyde (Ted Pella, Inc., Redding, CA) in 100 mM sodium cacodylate buffer ...
-
No products found
because this supplier's products are not listed.
Shanghang Shen, et al.,
bioRxiv - Neuroscience 2020
Quote:
... The animals were moved into a warm (37.0 ± 1 °C) recovery chamber (Product #DW-1, Harvard Apparatus, USA) to prevent postischemic hypothermia ...
-
No products found
because this supplier's products are not listed.
Shaun M. Christie, et al.,
bioRxiv - Biophysics 2021
Quote:
... Recombinant human Semaphorin 3A (CX65, Bon Opus Biosciences, Milburn, NJ) contains residues 21-771 and is >95% pure ...
-
No products found
because this supplier's products are not listed.
Thomas Keating, et al.,
bioRxiv - Immunology 2021
Quote:
... IgG-depleted exogenous pooled human complement was pre-incubated for 20 minutes at 4°C with PBS (control) or mouse anti-human C1q mAb (Hycult Biotech, Netherlands) at 1/5 dilution ...
-
No products found
because this supplier's products are not listed.
Megan N. Thomas, et al.,
bioRxiv - Microbiology 2023
Quote:
Serum samples collected from the indirect contact pigs at 11 DPC were prepared for the hemagglutination inhibition (HI) assay by receptor-destroying enzyme (RDE II; Hardy Diagnostics, Santa Maria, CA) treatment ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... His-tag antibody (Tiangen, Beijing, China) and GST antibody (Tiangen).
-
No products found
because this supplier's products are not listed.
Siran Zhu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
No products found
because this supplier's products are not listed.
Su Z. Hong, et al.,
bioRxiv - Neuroscience 2019
Quote:
... Viral injection of the recombinant adeno-associated virus expressing Cre recombinase under the control of human synapsin promoter (rAAV-hSyn-Cre; from SignaGen Laboratories, Rockville, MD) was done by bulk regional viral injection to the visual cortical area of neonatal Cre dependent Gs-DREADD mice at p1 ...
-
No products found
because this supplier's products are not listed.
Madeleine Blondin-Brosseau, et al.,
bioRxiv - Microbiology 2020
Quote:
... A new probe that would complement the primers and be compatible with TaqMan qPCR requirements (ABI 7700 Users Manual) was designed by using Integrated DNA Technologies (IDT ...
-
No products found
because this supplier's products are not listed.
Assaf Alon, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
Purified σ2 receptor was reconstituted into lipidic cubic phase (LCP) by mixing with a 10:1 (w:w) mix of monoolein (Hampton Research) with cholesterol (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Suhas Sureshchandra, et al.,
bioRxiv - Immunology 2020
Quote:
... in RPMI supplemented with 1% Human AB Serum (Omega Scientific) for 7 days with media supplemented on day 3 ...
-
No products found
because this supplier's products are not listed.
Jessy Carol Ntunzwenimana, et al.,
bioRxiv - Genetics 2021
Quote:
... Stable shRNA DUSP16 knockdown cell lines were derived in triplicate for each shRNA vector following selection with 3 ug/ml puromycin and were maintained at 37°C with 5% atmospheric CO2 in McCoy’s 5A (Modified) medium (cat no 317-010-CL, Wisent Bioproducts) supplemented with 10% FBS (cat F1051-500mL ...
-
No products found
because this supplier's products are not listed.
Anil H. Kadam, et al.,
bioRxiv - Bioengineering 2022
Quote:
... recombinant hu TGF-β1(ProSci, Poway, CA), anti-TGF-β1 IgY-Biotin (R&D Systems ...
-
No products found
because this supplier's products are not listed.
Andrew Frando, et al.,
bioRxiv - Microbiology 2022
Quote:
... where the LC component consisted of automated reversed-phase columns prepared in-house by slurry packing 3-μm Jupiter C18 (Phenomenex) into 35-cm x 360 μm o.d ...
-
No products found
because this supplier's products are not listed.
Agnès Roure, Rafath Chowdhury, Sébastien Darras,
bioRxiv - Developmental Biology 2022
Quote:
... or 2.5 μM of the BMP receptor inhibitor DMH1 (S7146, Euromedex, 10 mM stock solution in DMSO) at the stages indicated in the text and figures ...
-
No products found
because this supplier's products are not listed.
Qian Qin, et al.,
bioRxiv - Cancer Biology 2024
Quote:
The following section of the sequencing preparation was completed using kit components from the MAS-Seq for 10x Single Cell 3’ kit (PacBio, cat. no. 102-659-600), as well as individually created oligos ...
-
No products found
because this supplier's products are not listed.
Jothi K. Yuvaraj, et al.,
bioRxiv - Neuroscience 2020
Quote:
... after which cells were investigated for ligand-induced receptor activation using a FLUOstar Omega plate reader (BMG Labtech, Ortenberg, Germany). Cells were tested in triplicates (technical replicates ...
-
No products found
because this supplier's products are not listed.
Lin Zhuang, et al.,
bioRxiv - Molecular Biology 2023
Quote:
Human colon normal epithelial cells (FHC) and CRC cell lines (HT29 and LoVo ...
-
No products found
because this supplier's products are not listed.
Kurt Lucas, et al.,
bioRxiv - Immunology 2021
Quote:
Cell culture experiments were performed with human THP-1 acute monocytic leukemia cells (ATCC, LGC Standards GmbH, Wesel, Germany). Cells were grown in Roswell Park Memorial Institute (RPMI ...