-
No products found
because this supplier's products are not listed.
Khem Raj Giri, et al.,
bioRxiv - Immunology 2020
Quote:
... polyclonal rabbit anti-calnexin antibody (1:1000; Euromedex, Souffelweyersheim, France), β–actin (W16197A ...
-
No products found
because this supplier's products are not listed.
Esther B. Florsheim, et al.,
bioRxiv - Immunology 2023
Quote:
... or rabbit polyclonal anti-Fluoro-Gold primary antibody (1:1000 Fluorochrome) in the same blocking solution overnight for 16 h and then with Alexa Fluor 594-conjugated donkey anti-rabbit IgG secondary fluorescent antibody (1:500 dilution ...
-
No products found
because this supplier's products are not listed.
Francesca Pischedda, et al.,
bioRxiv - Neuroscience 2020
Quote:
Affinity-purified anti-P-Thr645-NSF polyclonal antibody was made in a NZW female rabbit (Envigo) by immunization against a single peptide (amino acids 631–656 ...
-
No products found
because this supplier's products are not listed.
David Marks, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Endogenous and overexpressed PML was immunofluorescently labelled with anti-PML antibody (rabbit, ABD-030, Jena Bioscience, Germany, 1:500), followed by secondary antibody coupled with STAR 580 STED dye (goat-anti-rabbit ...
-
No products found
because this supplier's products are not listed.
Monique Liebers, et al.,
bioRxiv - Plant Biology 2020
Quote:
... Rabbit polyclonal antibodies against PAP8 were produced by ProteoGenix. In Western blots PAP8 is detected at ~38 kDa ...
-
No products found
because this supplier's products are not listed.
Shijie Cao, et al.,
bioRxiv - Bioengineering 2023
Quote:
... and plasma was analyzed for anti-OVA total IgG antibodies using a mouse anti-OVA IgG antibody assay kit (Chondrex). On day 13 ...
-
No products found
because this supplier's products are not listed.
Zachary T. Morrow, John-Demian Sauer,
bioRxiv - Immunology 2022
Quote:
... 100 µL rabbit-α-mouse IFN-β polyclonal antibody (PBL assay science, #32400-1) at 1:2000 dilution in blocking buffer was added and the plate was incubated for 2 hours at room temperature ...
-
No products found
because this supplier's products are not listed.
Trevor J. Edwards, Jennifer L. Edwards,
bioRxiv - Microbiology 2022
Quote:
... Western Blots were probed with anti-C3 polyclonal antibody (Quidel).
-
No products found
because this supplier's products are not listed.
Robin Roychaudhuri, et al.,
bioRxiv - Biochemistry 2022
Quote:
... rabbit anti SLC7A10 polyclonal antibody (G-Biosciences; ITA8971).
-
No products found
because this supplier's products are not listed.
Verica Vasić, et al.,
bioRxiv - Neuroscience 2022
Quote:
... As primary antibody a polyclonal rabbit anti-human EGFL7 antibody (1:50, ReliaTech GmbH) was applied ...
-
No products found
because this supplier's products are not listed.
Qing Zhao, et al.,
bioRxiv - Immunology 2023
Quote:
... biotinylated flagellin peptides were conjugated on to Streptavidin coated 4um polystyrene beads (Spherotech, Inc. Cat # PAK-4067-8K). Beads conjugated with each individual peptide have different fluorescent intensity in the APC/Cy7 channel so that they can be differentiated from each other by flow cytometry ...
-
No products found
because this supplier's products are not listed.
Junko Yoshida, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... and anti-Nanog rabbit polyclonal antibody (1:200, Cat. RCAB002P-F, ReproCELL). Alexa Fluor 488-conjugated goat anti-mouse IgG (Cat ...
-
No products found
because this supplier's products are not listed.
Patrick Finneran, et al.,
bioRxiv - Biochemistry 2020
Quote:
... Cell Signaling Technology) as the primary antibody (1:2000 dilution) and ScanLater anti-rabbit antibody (Molecular Devices) as the secondary antibody (1:5000 dilution) ...
-
Cat# FL-04,
500 micrograms,USD $303.0
Ask
Hartwig Seitter, et al.,
bioRxiv - Neuroscience 2020
Quote:
The rabbit polyclonal anti-melanopsin antibody (Advanced Targeting Systems Cat# AB-N39, RRID:AB_1608076) was generated against the 15 N-terminal extracellular amino acids of mouse melanopsin ...
-
No products found
because this supplier's products are not listed.
Geraldine Nouailles, et al.,
bioRxiv - Immunology 2022
Quote:
... and rabbit anti hamster IgA antibody (Brookwood Biomedical, Jemison, AL, dilution: 1:250) were incubated at 4°C overnight followed by washing and incubation with a secondary biotinylated goat anti-mouse IgG antibody (dilution ...
-
No products found
because this supplier's products are not listed.
Ana Joaquina Jimenez, et al.,
bioRxiv - Cell Biology 2024
Quote:
... Cryosections were incubated with a rabbit polyclonal anti-Biotin antibody (Rockland/Tebu-Bio) followed by protein A-10nm gold conjugate (CMC ...
-
No products found
because this supplier's products are not listed.
Melanie Salvador, et al.,
bioRxiv - Microbiology 2023
Quote:
... 50 ng of human anti-S1 antibody (ACROBiosystems) was mixed with S1 protein and incubated at room temperature for three hours with gentle agitation before adding it to the culture media.
-
No products found
because this supplier's products are not listed.
Sandra Schwarz, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... The following anti-human antibodies were used from Immunotools: CD4-APC ...
-
No products found
because this supplier's products are not listed.
Anne-Perrine Foray, et al.,
bioRxiv - Immunology 2021
Quote:
... IFNγ was detected using biotinylated anti-IFNγ capture antibody (U-CyTech Biosicences), alkaline phosphatase conjugated ExtrAvidin (Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Pilar X. Altman, et al.,
bioRxiv - Immunology 2024
Quote:
... BLI assays to detect tyrosine sulfation by binding antibodies with anti-sulfotyrosine antibodies were performed using polypropylene black 384-well microplate (Greiner) at 30°C in octet buffer (0.05% Tween in PBS) ...
-
No products found
because this supplier's products are not listed.
Marion Le Rochais, et al.,
bioRxiv - Immunology 2022
Quote:
... tissues were incubated with a secondary antibody coupled to horseradish peroxidase (Polink-1 HRP for Rabbit & Mouse – GBI Labs Kit / AffiniPure Goat Anti-Rat IgG −112-005-143 ...
-
No products found
because this supplier's products are not listed.
Anno Saris, et al.,
bioRxiv - Immunology 2020
Quote:
... Anti-RBD and anti-NP IgG antibodies were measured in EDTA plasma samples at 100-1200 fold dilutions using ELISA as previously described.11 Plates were coated with RBD or N protein and specific IgG antibodies were detected using anti-human IgG (MH16, Sanquin).
-
No products found
because this supplier's products are not listed.
Annu Nummi, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Secondary antibody was an HRP-polymer anti-rabbit antibody (BiositeHisto Nordic Biosite cat. no KDB-Z47C3W). Immunoreactivity of antibodies was controlled in sections of porcine kidney ...
-
No products found
because this supplier's products are not listed.
Ludmila Recoules, et al.,
bioRxiv - Genomics 2021
Quote:
... Rabbit anti- mH2A1.1 antibody was generated according to immunization protocol from Agro-Bio - La fierté Saint-Aubin – France ...
-
No products found
because this supplier's products are not listed.
Yann Ehinger, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Rabbit anti-VGUT1 antibody (VGT1-3) was purchased from Mab Technologies (Stone Mountain, GA). Other common reagents were from Sigma Aldrich (St ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Jason Small, Alison Weiss,
bioRxiv - Microbiology 2021
Quote:
... Cells were washed with PBST and placed in primary antibody (Rabbit Anti-E. coli, cat. 1001, ViroStat, Rabbit Anti-Intimin ...
-
No products found
because this supplier's products are not listed.
Ellis L. Ryan, et al.,
bioRxiv - Cell Biology 2020
Quote:
... rabbit anti-chTOG (34032, QED Biosciences), mouse anti-TACC3 (ab56595 ...
-
No products found
because this supplier's products are not listed.
Noëlla Lopes, et al.,
bioRxiv - Immunology 2020
Quote:
... rabbit anti-Fezf2 (F441; IBL Tecan) and rabbit anti-involucrin (BioLegend ...
-
No products found
because this supplier's products are not listed.
Stefanie Lübke, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... rabbit anti-β -Gal 1:5000 (Biotrend), rabbit anti-GFP 1:500 (abcam) ...
-
No products found
because this supplier's products are not listed.
Jian Xing, et al.,
bioRxiv - Neuroscience 2022
Quote:
... axons were visualized at 2 weeks after optic nerve injury by immunostaining with the anti-CTB antibody (1:500; rabbit, GWB-7B96E4, GenWay) and fluorescent dye-conjugated secondary antibodies (1:500 ...
-
No products found
because this supplier's products are not listed.
Shahrnaz Kemal, et al.,
bioRxiv - Neuroscience 2023
Quote:
... then incubated in a secondary goat anti-rabbit antibody conjugated to 10-nm colloidal gold (Ted Pella, diluted 1:100) for 30 min at room temperature ...
-
No products found
because this supplier's products are not listed.
Jack George, Howard T. Jacobs,
bioRxiv - Molecular Biology 2019
Quote:
... custom rabbit polyclonal antibodies (21st Century Biochemicals, both 1:5000), GAPDH (Everest Biotech EB06377 ...
-
No products found
because this supplier's products are not listed.
Shoshik Amram, et al.,
bioRxiv - Neuroscience 2019
Quote:
... rabbit anti-p15 (1:50, Assay Biotechnology, # C0287), rabbit anti-laminb1 (1:200 ...
-
No products found
because this supplier's products are not listed.
BumJin Ko, et al.,
bioRxiv - Neuroscience 2022
Quote:
... rabbit anti-GFP (1:20, LF-PA0046, AbFrontier, South Korea) and goat anti-Drd4 (1:20 ...
-
No products found
because this supplier's products are not listed.
Nina Le Bert, et al.,
bioRxiv - Immunology 2020
Quote:
Sera were tested for anti-nucleoprotein (NP) IgG antibodies (CMIA, Abbott Laboratories) on an Abbott Architect i2000SR automated instrument ...
-
No products found
because this supplier's products are not listed.
Kenji Watari, et al.,
bioRxiv - Neuroscience 2023
Quote:
... The primary antibodies used were as follows: anti-Chx10 (sheep; 1:500; Exalpha), anti-Pax6 (mouse ...
-
No products found
because this supplier's products are not listed.
Chin-San Loo, et al.,
bioRxiv - Immunology 2020
Quote:
... All isolated Tregs were activated by plate bound anti-CD3 and anti-CD28 antibodies and cultured with X-VIVO 20 media (LONZA #04-448Q) supplemented by 1X Pen/Strep ...
-
Cat# HY-P2458,
inquire
Ask
Chengyao Chiang, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... the supernatant fractions were immunoprecipitated by incubation with magnetic beads conjugated with anti-HA or anti-Flag antibodies at 4°C overnight with rotation at 5 rpm (MedChemExpress, Monmouth Junction, NJ, USA). After washing the magnetic beads several times with wash buffer (25 mM Tris-HCl ...
-
No products found
because this supplier's products are not listed.
Xinglei Liu, Lu Rao, Arne Gennerich,
bioRxiv - Biophysics 2020
Quote:
... and incubated on ice with anti-GFP antibody Fab fragment-coated ∼1-μm diameter beads (980 nm, carboxyl-modified polystyrene microspheres, Bangs Laboratories) for 10 minutes ...
-
No products found
because this supplier's products are not listed.
Priti Singh, et al.,
bioRxiv - Genetics 2021
Quote:
... testes cross sections were double immunolabeled with TUNEL and anti-pH3 (see above) antibody and were imaged using a confocal microscope (u880, Carl Zeiss, Germany) with a Plan Apo 40× water immersion objective (1.1 NA ...
-
No products found
because this supplier's products are not listed.
Sushant Bhat, et al.,
bioRxiv - Microbiology 2021
Quote:
... (ID Vet) and Influenza A Antibody ELISA (IDEXX) were performed according to manufacturers’ instructions.
-
No products found
because this supplier's products are not listed.
Dora Pinto, et al.,
bioRxiv - Immunology 2020
Quote:
KD determination of full-length antibodies: Protein A biosensors (Pall ForteBio) were used to immobilize recombinant antibodies at 2.7 μg/ml for 1min ...
-
No products found
because this supplier's products are not listed.
Bradley M. Roberts, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Primary antibodies: rabbit anti-NeuN (1:500, Biosensis, R-3770–100). Sections were then incubated in species-appropriate fluorescent secondary antibodies with minimal cross-reactivity for 2 hours in PBS-Tx with 2% NDS at room temperature ...
-
No products found
because this supplier's products are not listed.
MegAnne Casey, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and rabbit anti-neuron-specific enolase (Polysciences). Secondary hydrogen peroxidase-conjugated antibodies ...
-
No products found
because this supplier's products are not listed.
Jilong Qin, Yaoqin Hong, Makrina Totsika,
bioRxiv - Microbiology 2023
Quote:
... polysaccharide samples separated by SDS-tricine gel electrophoresis were transferred onto nitrocellulose membrane and detected with rabbit polyclonal anti-O16 antibodies (SSI Diagnostica, #SSI85012).
-
No products found
because this supplier's products are not listed.
José Ignacio Gallea, et al.,
bioRxiv - Biophysics 2024
Quote:
... T4 samples were first incubated with a 1:50 solution of rabbit anti-wac (fibritin) antibody (2.95 mg/ml; CUSABIO, No. CSB-PA319157ZA01EDZ) in blocking solution for 1 hour ...
-
No products found
because this supplier's products are not listed.
Drishya Kurup, et al.,
bioRxiv - Microbiology 2020
Quote:
The following antibodies were used in this study: Anti-ZIKV-E mouse monoclonal antibody (Biofront Technologies, 1176-56), Pan-Flavivirus-E 4G2 mouse monoclonal antibody produced from hybridoma cell line D1-4G2-4-15 (ATCC ...
-
No products found
because this supplier's products are not listed.
Koji M Nishiguchi, et al.,
bioRxiv - Bioengineering 2019
Quote:
... incubated with mouse anti-mKO1 monoclonal antibodies (M104-3M, 1/200; MBL) overnight ...
-
No products found
because this supplier's products are not listed.
R Barbieri, et al.,
bioRxiv - Microbiology 2020
Quote:
... the paraffin sections were incubated with anti-glycophorin A antibody JC 159 (Mouse Monoclonal Antibody, ref: Mob 066-05, Diagnostic BioSystems, Nanterre, France) at a 1/500 dilution using a Ventana Benchmark autostainer (Ventana Medical Systems ...