-
No products found
because this supplier's products are not listed.
Geraldine Nouailles, et al.,
bioRxiv - Immunology 2022
Quote:
... and rabbit anti hamster IgA antibody (Brookwood Biomedical, Jemison, AL, dilution: 1:250) were incubated at 4°C overnight followed by washing and incubation with a secondary biotinylated goat anti-mouse IgG antibody (dilution ...
-
No products found
because this supplier's products are not listed.
Fan Bu, et al.,
bioRxiv - Cell Biology 2023
Quote:
... The secondary fluorescent antibodies was Goat anti rabbit (1:1000, L114A, GeneCopoeia, United States). Nuclei were stained with DAPI (4’,6-diamidino-2-phenylindole ...
-
No products found
because this supplier's products are not listed.
Jian Xing, et al.,
bioRxiv - Neuroscience 2022
Quote:
... axons were visualized at 2 weeks after optic nerve injury by immunostaining with the anti-CTB antibody (1:500; rabbit, GWB-7B96E4, GenWay) and fluorescent dye-conjugated secondary antibodies (1:500 ...
-
No products found
because this supplier's products are not listed.
Valentina Rossio, et al.,
bioRxiv - Biochemistry 2020
Quote:
Commercial antibodies used for Western blotting analysis were as follow: anti-Ube2C (A-650, Boston Biochem), anti-ubiquitin (P4D1 ...
-
No products found
because this supplier's products are not listed.
Ashok Pabbathi, et al.,
bioRxiv - Biophysics 2021
Quote:
... We washed out excess antibody with BRB80 and then incubated the flow channel with 1% Pluronic F-127 (PK-CA707-59000, PromoCell Inc., Heidelberg, Germany) for 5 min to passivate the surface ...
-
No products found
because this supplier's products are not listed.
Ashley Boice, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and immunodetected using appropriate primary and peroxidase-coupled secondary antibodies (Genesee Scientific). Proteins were visualized by West Pico and West Dura chemiluminescence Substrate (Thermo Fisher).
-
No products found
because this supplier's products are not listed.
Richard J Smith, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Images were acquired at 1×1 binning using a CoolSNAP HQ or HQ2 camera (Photometrics) and processed using softWorx software and ImageJ (National Institutes of Health) ...
-
No products found
because this supplier's products are not listed.
Daniela Saderi, Brad N. Buran, Stephen V. David,
bioRxiv - Neuroscience 2019
Quote:
... 1 to 4 high-impedance tungsten microelectrodes (FHC or A-M Systems, impedance 1-5 MΩ) were slowly advanced into cortex with independent motorized microdrives (Alpha-Omega) ...
-
No products found
because this supplier's products are not listed.
Panga Jaipal. Reddy, et al.,
bioRxiv - Biochemistry 2023
Quote:
Log phase B31 and MM1 Borrelia samples were analyzed using 5600+ Triple-TOF mass spectrometry (ABSciex, USA) coupled with Eksigent 400 nano-HPLC (Sciex, USA). Peptides from the 2 isolates were run separately by loading on trap column (200 μm × 0.5 mm ...
-
No products found
because this supplier's products are not listed.
Shoshik Amram, et al.,
bioRxiv - Neuroscience 2019
Quote:
... rabbit anti-p15 (1:50, Assay Biotechnology, # C0287), rabbit anti-laminb1 (1:200 ...
-
No products found
because this supplier's products are not listed.
Jack George, Howard T. Jacobs,
bioRxiv - Molecular Biology 2019
Quote:
... custom rabbit polyclonal antibodies (21st Century Biochemicals, both 1:5000), GAPDH (Everest Biotech EB06377 ...
-
No products found
because this supplier's products are not listed.
Annu Nummi, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Secondary antibody was an HRP-polymer anti-rabbit antibody (BiositeHisto Nordic Biosite cat. no KDB-Z47C3W). Immunoreactivity of antibodies was controlled in sections of porcine kidney ...
-
Cat# G209,
USD $10.00/EA
Ask
Shaowen White, et al.,
bioRxiv - Cell Biology 2020
Quote:
... 1:500 mouse anti-VP5 antibody (Biodesign), or 1:250 chicken anti-UL34 antiserum (Reynolds et al. ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
VG LeBlanc, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... Rabbit anti-Myelin Basic Protein (BMP) (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Kenji Watari, et al.,
bioRxiv - Neuroscience 2023
Quote:
... The primary antibodies used were as follows: anti-Chx10 (sheep; 1:500; Exalpha), anti-Pax6 (mouse ...
-
No products found
because this supplier's products are not listed.
Marion Le Rochais, et al.,
bioRxiv - Immunology 2022
Quote:
... tissues were incubated with a secondary antibody coupled to horseradish peroxidase (Polink-1 HRP for Rabbit & Mouse – GBI Labs Kit / AffiniPure Goat Anti-Rat IgG −112-005-143 ...
-
No products found
because this supplier's products are not listed.
Dyah W. Karjosukarso, et al.,
bioRxiv - Systems Biology 2023
Quote:
... pH 7.4), followed by secondary antibody anti-mouse IRDye 800 (1:4000, LiCor Biosciences) and DR (1:4000, Biostatus) for 1 hour at RT ...
-
No products found
because this supplier's products are not listed.
Edouard Leveque, et al.,
bioRxiv - Immunology 2021
Quote:
Colonic sections (5 µm) were saturated with PBS 1% BSA and then incubated with rabbit anti-CD3 (Clone SP7, Diagnostic BioSystems) monoclonal antibody (mAb ...
-
No products found
because this supplier's products are not listed.
Toshiyuki Ueki, et al.,
bioRxiv - Synthetic Biology 2019
Quote:
... and the HA Tag Polyclonal Antibody as primary antibodies and an anti-mouse IgG-gold (40 nm) antibody (40 nm Goat Anti-Mouse IgG gold conjugate, Expedeon) and the anti-rabbit IgG-gold (10 nm ...
-
No products found
because this supplier's products are not listed.
Tomotaka Okamura, et al.,
bioRxiv - Immunology 2020
Quote:
... flat-bottom plates were coated with an anti-IFN-γ monoclonal antibody (clone MD-1; U-Cytech, Utrecht, Netherlands) and blocked with 2% BSA in PBS ...
-
No products found
because this supplier's products are not listed.
Arjen J. Boender, Raffaella Tonini,
bioRxiv - Neuroscience 2020
Quote:
... We normalized the expression of EAAT2 to the expression of primary rabbit anti-calnexin (ABI-SPA-860 ...
-
No products found
because this supplier's products are not listed.
Hoyun Kwak, et al.,
bioRxiv - Genetics 2020
Quote:
... Vectors that encoded the anti-FAM19A5-IgG1 antibody were transfected into HEK293F cells and the recombinant antibody was purified using Protein A beads (RepliGen). Anti-FAM19A5 antibodies that recognized the epitopes formed at N-terminal and C-terminal regions were generated and called N-A5-Ab and C-A5-Ab ...
-
No products found
because this supplier's products are not listed.
Anu G. Nair, Paola Muttathukunnel, Martin Müller,
bioRxiv - Neuroscience 2021
Quote:
... and Atto594 conjugated anti-mouse (ATTO-TEC; 1:100). Images were acquired using an upright Leica Stellaris or inverted Leica SP8 laser scanning microscope (University of Zurich Center for Microscopy and Image Analysis ...
-
No products found
because this supplier's products are not listed.
Swastik Phulera, et al.,
bioRxiv - Biophysics 2024
Quote:
... The virus titer was determined by gp64-PE mouse anti-baculovirus antibody (Expression Systems, CA) using a Guava benchtop Flow Cytometer (Millipore ...
-
No products found
because this supplier's products are not listed.
Esther B. Florsheim, et al.,
bioRxiv - Immunology 2023
Quote:
... Capture antibodies were the same as for total IgE assay and 8 mg/mL of biotinylated OVA (OVA1-BN-1, Nanocs) was used for detection ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... and GST antibody (Tiangen).
-
No products found
because this supplier's products are not listed.
Khushboo Borah, et al.,
bioRxiv - Systems Biology 2022
Quote:
... Media was pumped into the chemostat using a peristaltic pump (Rainin Rabbit Plus). Cultures were grown for 3-4 volume changes in the unlabelled media to assure a metabolic steady-state before introducing isotopically labelled media ...
-
No products found
because this supplier's products are not listed.
Sushant Bhat, et al.,
bioRxiv - Microbiology 2021
Quote:
... (ID Vet) and Influenza A Antibody ELISA (IDEXX) were performed according to manufacturers’ instructions.
-
No products found
because this supplier's products are not listed.
M. Julhasur Rahman, et al.,
bioRxiv - Microbiology 2021
Quote:
... the RK13 cells we used were confirmed to be of European rabbit (Oryctolagus cuniculus) origin by PacBio sequencing (ArrayExpress accession ...
-
No products found
because this supplier's products are not listed.
Simon N. Chu, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... 3% antibody serum (heat-inactivated; Atlanta Biologicals, Flowery Branch, GA, USA), 2% human plasma (from umbilical cord blood) ...
-
No products found
because this supplier's products are not listed.
Matthew F. Poyton, et al.,
bioRxiv - Biophysics 2021
Quote:
... which is 240,600 mol-1 cm-1 (obtained from Lumiprobe). The calculated Forster radius for the Cy3-Cy7 FRET pair was 4.0 nm ...
-
No products found
because this supplier's products are not listed.
Erick X. Pérez-Guzmán, et al.,
bioRxiv - Microbiology 2019
Quote:
... anti-ZIKV IgG (XPressBio, Frederick, MD, USA) at baseline ...
-
No products found
because this supplier's products are not listed.
Dimitre R. Simeonov, et al.,
bioRxiv - Immunology 2020
Quote:
... 1 photomultiplier tube (PMT), 40x (NA = 1.3 ...
-
No products found
because this supplier's products are not listed.
Megan A. Outram, et al.,
bioRxiv - Plant Biology 2023
Quote:
... mixed 1:1 with the labelled protein and loaded into standard capillaries (NanoTemper Technologies). MST measurements were recorded using 20 % LED power and 20 to 80 % MST power and analysed using MO ...
-
No products found
because this supplier's products are not listed.
Hila Shaim, et al.,
bioRxiv - Immunology 2020
Quote:
... 1 μg cas9 (PNA Bio) and 500 ng of each sgRNA were incubated on ice for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Jing-Xiang Wu, Rui Liu, Kangcheng Song, Lei Chen,
bioRxiv - Biochemistry 2020
Quote:
... 2 mM EGTA] containing 1 mM phenylmethanesulfonyl fluoride (PMSF) and 1% (w/v) digitonin (Biosynth) at 4°C for 50 min ...
-
No products found
because this supplier's products are not listed.
Ming-Xuan Tang, et al.,
bioRxiv - Microbiology 2021
Quote:
... source 1 agar (BIO BASIC, FB0010), source 2 Agar (Sangon Biotech ...
-
No products found
because this supplier's products are not listed.
Adam S Hassan, et al.,
bioRxiv - Immunology 2019
Quote:
... 1 mM L-glutamine (all from Wisent Bioproducts), 0.05 mM 2-mercaptoethanol (Sigma-Aldrich) ...
-
No products found
because this supplier's products are not listed.
Moitrayee Bhattacharyya, et al.,
bioRxiv - Biophysics 2019
Quote:
... the glass substrates were treated with a mixture of Poly-L-lysine PEG and PEG-Biotin (1000:1, both at 1 mg/mL) for 30 minutes (SuSoS, Dübendorf, Switzerland). The glass substrates were then washed with 2 mL of Dulbecco’s phosphate-buffered saline (DPBS ...
-
No products found
because this supplier's products are not listed.
Eric A. Kirk, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Anesthesia was induced with isoflurane (1-5%, Kent Scientific), eye lubricant was applied ...
-
No products found
because this supplier's products are not listed.
James T. McKenna, et al.,
bioRxiv - Neuroscience 2020
Quote:
Mice were deeply anesthetized with isoflurane (1-3%) and viral injections were performed using a 1 µl Hamilton syringe (Cat#7001KH, Point Style 3, Hamilton Company, Reno, NV, USA), targeting BF (AP +0.14 mm ...
-
No products found
because this supplier's products are not listed.
Tao Zhang, et al.,
bioRxiv - Plant Biology 2022
Quote:
... and 1/16” stainless steel tubing were acquired from IDEX Health & Sciences (Oak Harbor ...
-
No products found
because this supplier's products are not listed.
Rodney M. Ritzel, et al.,
bioRxiv - Neuroscience 2022
Quote:
... sections were mounted onto glass slides with coverslips using an anti-fade Hydromount solution (National Diagnostics). The following primary and secondary antibodies were used ...
-
No products found
because this supplier's products are not listed.
Yann Ehinger, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Rabbit anti-VGUT1 antibody (VGT1-3) was purchased from Mab Technologies (Stone Mountain, GA). Other common reagents were from Sigma Aldrich (St ...
-
No products found
because this supplier's products are not listed.
Rodrigo Dutra Nunes, Daniela Drummond-Barbosa,
bioRxiv - Physiology 2023
Quote:
... 1 (Spectrum Chemicals), respectively ...
-
No products found
because this supplier's products are not listed.
Hang Ma, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Serially diluted antibodies were incubated with wild-type (Yeasen) or mutant pseudoviruses (GENEWIZ) for 0.5 h at 37°C ...
-
No products found
because this supplier's products are not listed.
Giselle C. Wong, et al.,
bioRxiv - Microbiology 2021
Quote:
... for six weeks (Table 1; Research Diets, Brunswick ...
-
No products found
because this supplier's products are not listed.
Marta Urbanska, et al.,
bioRxiv - Biophysics 2021
Quote:
... 1 mM EDTA) using 1 ml Float-A-Lyzer G2 Dialysis Device with molecular cutoff of 1000 kDa (G235037, Spectrum Labs). The dialysis buffer was exchanged 5 times with 4–16 h intervals.
-
No products found
because this supplier's products are not listed.
Siranush Babakhanova, et al.,
bioRxiv - Molecular Biology 2021
Quote:
Two-photon spectrum and cross sections of TagRFP658 were measured in PBS buffer at concentrations ∼1–5·10−5 M in 1 mm glass spectroscopy cuvettes (Starna cells) using an MOM two-photon fluorescent microscope (Sutter Instrument ...