-
No products found
because this supplier's products are not listed.
Sherif Salah, et al.,
bioRxiv - Immunology 2022
Quote:
... and membrane protein peptide (by AMSBIO) were procured ...
-
No products found
because this supplier's products are not listed.
Eric Waltari, et al.,
bioRxiv - Immunology 2019
Quote:
... Blocking solution (sciBLOCK Protein D1M solution, Scienion) was added at 200 μL/well with a multichannel pipet and allowed to incubate without agitation for 1 hour ...
-
No products found
because this supplier's products are not listed.
Rie Ayukawa, et al.,
bioRxiv - Biophysics 2020
Quote:
... The EM images of the WT and Y222F MTs were captured by an UltraScan 4000 CCD camera (GATAN) at nominal magnification of 50,000 with 0.213 nm/pixel and by a Falcon II direct electron detector (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Ankit Sabharwal, et al.,
bioRxiv - Genetics 2021
Quote:
... Primers flanking the MT-ND4 gene were used to amplify the edited locus using MyTaq polymerase (Bioline, USA). PCR amplicons were gel extracted and purified using QIAquick Gel Extraction Kit (Qiagen ...
-
No products found
because this supplier's products are not listed.
Ly Porosk, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Peptide-based transfection reagent Reagent007 from Icosagen suitable for suspension cells ...
-
No products found
because this supplier's products are not listed.
Natalie K. Horvat, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... MT-5 cell line were also transduced to stably express luciferase using LentifectTM (GeneCopoeia #LPP-HLUC-Lv105-025-C) lentiviral vectors of firefly luciferase ...
-
No products found
because this supplier's products are not listed.
Tommaso Montecchi, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... SEB and SEE peptides (2μg/ml) (Toxin Technology) or 1% BSA for controls ...
-
No products found
because this supplier's products are not listed.
Rick G. Kim, et al.,
bioRxiv - Plant Biology 2024
Quote:
... Biotinylated peptides were searched using exogenous biotin (ExBio) on lysine as a variable modification ...
-
No products found
because this supplier's products are not listed.
Rie Ayukawa, et al.,
bioRxiv - Biophysics 2020
Quote:
... The grids of the WT and Y222F MTs were observed at liquid nitrogen temperature by using a JEM 2100F electron microscope (JEOL) operated at 200 kV and a Tecnai Arctica electron microscope (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
John Campbell McNamara, et al.,
bioRxiv - Physiology 2022
Quote:
... The muscle fragments were placed in previously weighed Eppendorf microtubes (MT) and weighed immediately on an electronic analytical balance (Ohaus Analytical Plus AP250D ...
-
No products found
because this supplier's products are not listed.
László Imre, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Cyclodextrin/peptide complex formation was performed by mixing 30 μM peptide and 300 μM SBECD (Sulfobutylether-β-Cyclodextrin; CycloLab, Budapest, Hungary) diluted in colorless ...
-
No products found
because this supplier's products are not listed.
Kamyab Javanmardi, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Membranes were blocked in LICOR Odyssey Blocking Buffer (Neta Scientific) incubated with the following primary antibodies overnight ...
-
No products found
because this supplier's products are not listed.
Anne-Sophie Hafner, et al.,
bioRxiv - Neuroscience 2019
Quote:
... After 30 min in blocking buffer cells were incubated with mouse anti-puromycin (Kerafast, 1:2000) for 1 h at room temperature ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Peter Verstraelen, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Permeabilization was done in blocking buffer (0.1% bovine serum albumin, 10% normal horse serum (Innovative Research IGHSSER) in PBS ...
-
No products found
because this supplier's products are not listed.
Chiara Aloise, et al.,
bioRxiv - Microbiology 2023
Quote:
... The cells were then incubated in blocking buffer containing mouse anti-dsRNA (1:1000; English & Scientific Consulting), goat anti-eIF3η (1:200 ...
-
No products found
because this supplier's products are not listed.
Ji-Hoon Lee, et al.,
bioRxiv - Bioengineering 2024
Quote:
... incubated with primary antibody against spike protein diluted 1:5,000 in blocking buffer (Elabscience, E-AB-V1006) overnight in a 37°C incubator with 5% CO2 injection ...
-
No products found
because this supplier's products are not listed.
The Nhu Nguyen, et al.,
bioRxiv - Microbiology 2023
Quote:
Antibody responses against IAV-S nucleoprotein (NP) were measured by using a commercial blocking ELISA (IDEXX, Montpellier, France), following the manufacturer’s recommendation ...
-
No products found
because this supplier's products are not listed.
Nikolas Nikolaou, et al.,
bioRxiv - Neuroscience 2020
Quote:
... This was removed and coverslips were incubated with fresh blocking solution containing anti-GFP 1:1000 (Torrey Pines Biolabs-TP401) and anti-SNRNP70 1:200 (Sigma-AV40276 ...
-
No products found
because this supplier's products are not listed.
Colton D. Payne, et al.,
bioRxiv - Biochemistry 2020
Quote:
... The resin used as an anchor for peptide assembly was Tentagel XV 4-hydroxymethyl phenoxyacetic acid (Rapp Polymere, GmbH). Prior to the loading of the C-terminal residue ...
-
No products found
because this supplier's products are not listed.
Jhansi L. Leslie, et al.,
bioRxiv - Microbiology 2019
Quote:
... each plate had a positive control consisting of toxin coated wells reacted with mouse TcdA monoclonal antibody TGC2 diluted 1:5,000 in blocking buffer (antibodies-online.com ABIN335169). The optical density at 410nm and 650nm was recorded on a VersaMax plate reader (Molecular Devices ...
-
No products found
because this supplier's products are not listed.
Takafumi Kato, et al.,
bioRxiv - Pathology 2021
Quote:
... PRR4 cDNA without a signal peptide sequence (corresponding to amino acids 17 to 134) was cloned into the pM-secSUMOstar Vector (7121, LifeSensors). SUMOstar-PRR4 vectors were transfected into Expi293 cells (1 mg of DNA per liter of transfection ...
-
No products found
because this supplier's products are not listed.
Wenwei Li, et al.,
bioRxiv - Microbiology 2021
Quote:
... Crystal screening of Fab-peptide complexes were performed using the vapor-diffusion hanging drop method using the sparse matrix crystallization screens ProPlex (Molecular Dimensions), Index (Hampton Research) ...
-
No products found
because this supplier's products are not listed.
Michela Carlet, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... using a 5’ primer carrying NsiI and a 3’ primer carrying P2A-NsiI and ligated into the NsiI digested pCDH-SFFV-GLuc-T2A-mCherry vector downstream of the T2A peptide (Figure S2a) (pCDH-vector, System Bioscience). For inducible knockdown of target genes ...
-
No products found
because this supplier's products are not listed.
Toshiharu Ichinose, et al.,
bioRxiv - Neuroscience 2024
Quote:
... The ribosome-bound mRNA was eluted with 50 µl of 100 µg/ml 3× FLAG peptide (GEN-3XFLAG- 25, Protein Ark) dissolved in the lysis buffer.
-
No products found
because this supplier's products are not listed.
Anuli C. Uzozie, et al.,
bioRxiv - Cancer Biology 2019
Quote:
Dried samples were resuspended in 0.1% TFA in 80% acetonitrile and phosphorylated peptides were purified by immobilized metal affinity chromatography (IMAC) using Fe-NTA MagBeads (Cube Biotech, Monheim, Germany). Sample solution was added to beads washed with 0.1% TFA in 80% acetonitrile ...
-
No products found
because this supplier's products are not listed.
Akesh Sinha, et al.,
bioRxiv - Immunology 2024
Quote:
... peptide (YPYDVPDYAGAGC) or N-terminally biotinylated HA peptide (Bio-HA) (GL Biochem Ltd., Shanghai, China) or HER2 extracellular domain (ECD) (Acrobiosystems, Newark, DE, USA) was used as antigen in ELISAs ...
-
No products found
because this supplier's products are not listed.
Koen Kole, et al.,
bioRxiv - Neuroscience 2022
Quote:
... mt-GCaMP6f: AAV1) and transfer plasmids were mixed and diluted in saline before mixing with saline-diluted polyethylenimine (PEI, Polysciences #23966-2) and brief vortexing ...
-
No products found
because this supplier's products are not listed.
Gregory A. Breuer, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... Blocking was performed in TBS-T with 5% BSA (Gold Biotechnology) for 1h at room temperature ...
-
No products found
because this supplier's products are not listed.
Emily Tubbs, et al.,
bioRxiv - Bioengineering 2024
Quote:
... The cells were permeabilized by a blocking buffer containing FBS (ScienCell Research Laboratories ...
-
Atrial Natriuretic Peptide ( ANP ) ELISA / Assay Kit
Cat# K071-H1,
1.0 ea, USD $385.0
Ask
Soon Yew Tang, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
Atrial natriuretic peptide (Arbor Assays, K026-H1, Ann Arbor, MI), total nitrate+nitrite (Cayman Chemical ...
-
No products found
because this supplier's products are not listed.
Breanna Q. Shen, et al.,
bioRxiv - Neuroscience 2022
Quote:
Slides were incubated with blocking buffer (10% Normal Goat Serum, Atlanta Biologicals, Cat #S13150h ...
-
No products found
because this supplier's products are not listed.
Samir M. Abdelmagid, et al.,
bioRxiv - Cell Biology 2020
Quote:
The MicroVue™ Helical Peptide EIA kit (Quidel, San Diego, CA) was used to measure the level of a helical peptide containing the residues 620-633 of the type I collagen α1 chain or more formally carboxy-terminal collagen crosslinks ...
-
No products found
because this supplier's products are not listed.
Belinda Liu, et al.,
bioRxiv - Biochemistry 2019
Quote:
... or the insulin receptor signal peptide were synthesized by Eton Biosciences. Similarly ...
-
No products found
because this supplier's products are not listed.
Francesco Caiazza, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... and peptides desalted with C18 Desalting Tips (Rainin, Oakland, CA, USA), lyophilized ...
-
No products found
because this supplier's products are not listed.
Joshua Johnson, et al.,
bioRxiv - Physiology 2020
Quote:
... Endogenous peroxidase blocking was performed by using 3% hydrogen peroxide (Labchem, Cat # LC154301). Sections were then washed in water ...
-
No products found
because this supplier's products are not listed.
Diogo F.T. Veiga, et al.,
bioRxiv - Genomics 2020
Quote:
... non-unique-PacBio+Uniprot (peptides mapped to both PacBio and Uniprot proteins), and multigene (peptides mapped to multiple genes).
-
The peptide is used to block Anti-MT-ND2 Antibody (#CPA1771) reactivity.
Cat# CBP1771,
1 mg USD $100.0, 5 mg USD $300.0
Ask
Rafał Zdrzałek, et al.,
bioRxiv - Plant Biology 2024
Quote:
... membranes were incubated with appropriate antibodies diluted in blocking buffer (α-FLAG: Cohesion Biosciences, at 1:3000 dilution ...
-
No products found
because this supplier's products are not listed.
Bijal A. Parikh, et al.,
bioRxiv - Immunology 2019
Quote:
... Fc receptor blocking was performed with 2.4G2 (anti-FcγRII/III) hybridoma (American Type Culture Collection) culture supernatants ...
-
No products found
because this supplier's products are not listed.
Mark J. Wall, et al.,
bioRxiv - Physiology 2020
Quote:
... Peptides for interfering with G protein signalling were obtained from Hello Bio (Bristol, UK) and were based on published sequences16 ...
-
No products found
because this supplier's products are not listed.
Logan S. Richards, et al.,
bioRxiv - Biochemistry 2021
Quote:
... The peptide crystals were harvested from hanging drops using CryoLoops™ from Hampton Research with no additional cryoprotectant other than the MPD already present and flash-frozen in liquid nitrogen ...
-
No products found
Matthias Felten, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Proteolysis into peptides was accomplished using 0.5% (w/w) Trypsin (sequencing grade; Worthington Biochemical) (37 °C ...
-
No products found
because this supplier's products are not listed.
Lydia Zhang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Peptides were diluted in water and acidified with 1.2M formic acid (Thomas Scientific, A11750) in preparation for mass spectrometry analysis.
-
No products found
because this supplier's products are not listed.
Jesse Goyette, et al.,
bioRxiv - Immunology 2020
Quote:
... For the avitag-CD3ζ ITAM3 peptide DNA construct BirA-transformed BL21 (DE3) Escherichia coli (BPS Bioscience) were used ...
-
No products found
because this supplier's products are not listed.
Gema M. Olivarria, et al.,
bioRxiv - Microbiology 2021
Quote:
... Cells were incubated overnight at 4°C in blocking solution with primary antibodies anti-MAP2 (EnCor Biotech. Cat:NC0388389) and anti-SARS-CoV-2 nucleocapsid (Sino Bio ...
-
No products found
because this supplier's products are not listed.
Andrew T. Phillips, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Wells were then washed 4 times with TBST and then incubated in 1x Blocking Buffer in PBS with a 1:10,000 dilutions of either β1- (Assay Biotechnology; San Francisco ...
-
No products found
because this supplier's products are not listed.
Sylvain Perriot, et al.,
bioRxiv - Immunology 2024
Quote:
... transfected Jurkat cells and co-culture with HLA-unenhanced neurons or in presence of a blocking anti-HLA ABC antibody (W6/32, AffinityImmuno). Luminescence was measured with a Multimode Microplate Reader (BioTek Synergy) ...
-
No products found
because this supplier's products are not listed.
Frank Hidalgo, et al.,
bioRxiv - Biophysics 2022
Quote:
... Peptides were desalted for 4 minutes on a trap column (1 mM ID x 2 cm, IDEX C-128) manually packed with POROS R2 reversed-phase resin (Thermo Scientific 1112906) ...
-
No products found
because this supplier's products are not listed.
Zahra Hosseinzadeh, et al.,
bioRxiv - Bioengineering 2023
Quote:
... The insulin of each sample was measured with the C-Peptide & Insulin AccuBind VAST ELISA Kits (Monobind Inc., USA). Three independent experiments were performed for each group ...
-
No products found
because this supplier's products are not listed.
Erin M. Euliano, et al.,
bioRxiv - Bioengineering 2024
Quote:
... Near-infrared fluorescent peptides were made by coupling 2 equivalents N-hydroxysuccinimide (NHS) ester-functionalized ATTO 647N (ATTO-TEC, Siegen, Germany) to the N-terminus with 4 equivalents of DIEA overnight protected from light ...