-
No products found
because this supplier's products are not listed.
Yan Li, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or anti-PAC1 receptor (1:50 dilution, LifeSpan BioSciences, Inc.) at 4°C overnight ...
-
No products found
because this supplier's products are not listed.
Amit Pathania, et al.,
bioRxiv - Microbiology 2020
Quote:
... Three fatty acids (C14:0; myristic acid, C16:0; palmitic acid and C18:1; oleic acid;, Larodan Fine Chemicals, Sweden) were prepared as 100 mM stocks in DMSO and used at final equimolar concentrations of 0.17 mM each in experiments (referred as eFA) ...
-
No products found
because this supplier's products are not listed.
Krishnapriya Hari, et al.,
bioRxiv - Neuroscience 2021
Quote:
... including anti-α5 GABAA receptor subunit (AAP34984, Aviva Systems Biology, San Diego, USA), anti-α1 GABAA receptor subunit (224-2P ...
-
No products found
because this supplier's products are not listed.
Raife Dilek Turan, et al.,
bioRxiv - Immunology 2021
Quote:
5 μg / ml of SARS-COV-2 Spike S1 Monoclonal Antibody (ElabScience) antibodies were added in the gel at a concentration of 2% ...
-
No products found
because this supplier's products are not listed.
Meng Zhang, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Fluorescence intensity of Tb3+-labelled receptors was measured on an Infinite M1000 fluorescence plate reader (Tecan) with an excitation wavelength of 340 nm and emission wavelength of 620 nm ...
-
No products found
because this supplier's products are not listed.
Olena Kim, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Secondary antibodies goat anti-rabbit 5-nm gold conjugated (BBI Solutions, Cat # EM GAR5, RRID:AB_1769142) and goat anti-guinea pig 10-nm gold conjugated (BBI Solutions ...
-
No products found
because this supplier's products are not listed.
Judit R. Pungor, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and 2% pluronic acid (AAT Bioquest) in ASW was injected into one of the optic lobes using a glass micropipette needle (Harvard Apparatus Cat ...
-
No products found
because this supplier's products are not listed.
Nir Salinas, et al.,
bioRxiv - Biochemistry 2020
Quote:
... Incubated bacteria (5 μl) were dispersed on 5×5 mm silicon wafers (Ted Pella, USA) that had been prewashed with ethanol ...
-
No products found
because this supplier's products are not listed.
Anna L. Vlasits, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Boroscillate pipettes (Sutter Instruments, 3-5 MΩ) were used for all recordings and whole-cell electrophysiology recordings were performed using a Multiclamp 700B amplifier (Molecular devices) ...
-
No products found
because this supplier's products are not listed.
Paul Cheng, et al.,
bioRxiv - Cell Biology 2020
Quote:
... and then incubated with PBS with 5% BSA and 5% FBS or Rodent Block M reagent (RBM961; Biocare Medical) for 60□min.
-
No products found
because this supplier's products are not listed.
Mohan Kumar Muthu Karuppan, et al.,
bioRxiv - Immunology 2019
Quote:
... Pregnant dams received anti-interferon receptor 1 (anti-IFNAR1) monoclonal antibody (MAR-5A3, Leinco Technologies, MO, USA) at 2mg/animal via intraperitoneal (ip ...
-
No products found
because this supplier's products are not listed.
Zhaoyang Liu, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... followed by 5 days of decalcification in Formic Acid Bone Decalcifier (Immunocal, StatLab). After decalcification ...
-
No products found
because this supplier's products are not listed.
Mohita Tagore, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... or DMH1 (BMP receptor, Sigma #D8946, 0.5 µM) or EC330 (LIF receptor ...
-
No products found
because this supplier's products are not listed.
Nicholas J Swanson, et al.,
bioRxiv - Microbiology 2023
Quote:
... Lyophilized Receptor Destroying Enzyme II (RDE, Hardy Diagnostics) was dissolved into 20 mL of saline (0.9% NaCl in H2O ...
-
No products found
because this supplier's products are not listed.
Brogan Ashley, et al.,
bioRxiv - Physiology 2021
Quote:
... or 2 μM Receptor Associated Protein (RAP; Innovative Research, USA), which block pinocytosis ...
-
No products found
because this supplier's products are not listed.
MT Heemskerk, et al.,
bioRxiv - Immunology 2021
Quote:
... diluted in PBS for 10 min at RT and Fc-receptors were subsequently blocked using 5% human serum (HS; Sanquin Blood bank, Amsterdam, The Netherlands) for 45 min at RT ...
-
No products found
because this supplier's products are not listed.
Juliane Tschuck, et al.,
bioRxiv - Cell Biology 2023
Quote:
For inhibition of different receptors and proteins we used HX 531 (Biomol) as a pan-Retinoic Acid Receptor (RAR ...
-
No products found
because this supplier's products are not listed.
Kishore K. Joshi, et al.,
bioRxiv - Neuroscience 2020
Quote:
... pH 7.5 and 0.5 mM ethylenediaminetetraacetic acid) containing a chymotryptic substrate (80 μM Suc-Leu-Leu-Val-Tyr -AMC; Boston Biochem). Reactions were incubated at 25°C for 1 h ...
-
No products found
because this supplier's products are not listed.
Allison R. Fusilier, et al.,
bioRxiv - Neuroscience 2021
Quote:
... BMAL1 (1:1000 in 5% BSA and TBST, Signalway Antibody, LLC, #21415,), GSK3β (3D10 ...
-
No products found
because this supplier's products are not listed.
Amanda Bentley-DeSousa, Michael Downey,
bioRxiv - Molecular Biology 2021
Quote:
... supplemented with 1/10 volume of 1.5M Tris-HCl pH 8.8 (Tris Base Fisher BP152-5, Hydrochloric Acid Fisher A144-212) and 1/10 volume 1 M DTT (Bio Basic DB0058). Samples were boiled for 5 minutes before an additional centrifugation at 4 °C at 16,000 x g for 4 minutes.
-
No products found
because this supplier's products are not listed.
Bijal A. Parikh, et al.,
bioRxiv - Immunology 2019
Quote:
... Fc receptor blocking was performed with 2.4G2 (anti-FcγRII/III) hybridoma (American Type Culture Collection) culture supernatants ...
-
No products found
because this supplier's products are not listed.
Bao Gia Vu, W. Scott Moye-Rowley,
bioRxiv - Genetics 2021
Quote:
... or under amino acid-selective conditions in complete supplemental medium (CSM) (Difco yeast nitrogen extract without amino acids, amino acid powder from Sunrise Science Products, 2% μg/ml nourseothricin (Jena Bioscience ...
-
No products found
because this supplier's products are not listed.
Jennifer Reck, et al.,
bioRxiv - Cell Biology 2021
Quote:
... 50 μl 2 M hydrochloric acid and 50 μl of 5% trifluoroacetic acid were added and peptides collected using BioPureSPN Mini C18 spin columns (Part #HUMS18V from The Nest Group) and analyzed with an Orbitrap Elite Mass Spectrometer (Thermo Scientific ...
-
No products found
because this supplier's products are not listed.
Grace Ying Shyen Goh, et al.,
bioRxiv - Genetics 2022
Quote:
... and PUFAs (mix of fatty acid sodium salts: 150 μM C18:2, S-1127; 150 μM C20:5, S-1144, Nu-Chek Prep). E ...
-
No products found
because this supplier's products are not listed.
Lorena Galera-López, et al.,
bioRxiv - Neuroscience 2021
Quote:
... a mixture of equal amounts (1:100) of guinea pig anti-CB1R antibody (Frontier Science) and rabbit anti-5-HT2AR antibody (Neuromics) was used together with PLA probes detecting guinea pig or rabbit antibodies ...
-
No products found
because this supplier's products are not listed.
Danielle Sadowski, et al.,
bioRxiv - Developmental Biology 2024
Quote:
... 0.8 mM Valproic Acid (Amsbio), 5 µM A83-01 (Tocris Bioscience) ...
-
No products found
because this supplier's products are not listed.
Michael J. Capper, et al.,
bioRxiv - Biochemistry 2022
Quote:
... or AE1-Niflumic acid at 5 mg/ml were applied to glow-discharged holey carbon EM grids (Quantifoil 300 copper mesh, R1.2/1.3) in an EM-GP2 plunge freezer (Leica) ...
-
No products found
because this supplier's products are not listed.
Antwi-Boasiako Oteng, et al.,
bioRxiv - Physiology 2021
Quote:
... non-esterified fatty acids (Wako Diagnostics), and cholesterol (Cholesterol E ...
-
No products found
because this supplier's products are not listed.
Chirag H Patel, et al.,
bioRxiv - Immunology 2023
Quote:
... containing chimeric antigen receptor (CAR) was made using Platinum-E (Plat-E) Retroviral Packaging Cell Line (Cell Biolabs). Fresh virus with human IL-2 was spin fected onto retronectin coated plates according to protocol (33156338) ...
-
No products found
because this supplier's products are not listed.
Shuting Cao, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... The Control diet (A11112201) contained all essential amino acids and nonessential amino acids as specified by Research Diets. Glutamine-supplemented diet contained all amino acids equal to the control diet with the addition of 200 g of glutamine by Ishak Gabra [43] ...
-
No products found
because this supplier's products are not listed.
Samuel K Powell, et al.,
bioRxiv - Neuroscience 2021
Quote:
... diluted primary antibodies were added in 5% donkey serum and 0.1% Tween-20 (Boston BioProducts, #IBB-181X) in PBS and incubated overnight at 4 °C ...
-
No products found
because this supplier's products are not listed.
Jothi K. Yuvaraj, et al.,
bioRxiv - Neuroscience 2020
Quote:
... after which cells were investigated for ligand-induced receptor activation using a FLUOstar Omega plate reader (BMG Labtech, Ortenberg, Germany). Cells were tested in triplicates (technical replicates ...
-
No products found
because this supplier's products are not listed.
Melissa Govender, et al.,
bioRxiv - Immunology 2022
Quote:
... including anti-spike neutralizing IgG antibodies directed against the receptor binding domain (RBD) of S1 subunit was performed using a commercial chemiluminescent microparticle-based immune assay (Abbott SARS-CoV-2 IgG II Quant/6S60 ARCHITECT SARS-CoV-2 IgG kit ...
-
No products found
because this supplier's products are not listed.
Jonathan A Flores, et al.,
bioRxiv - Biophysics 2020
Quote:
... Amino acids corresponding to the intracellular loop (ICL; residues 110–136 in sheep Cx46 and residues 110–148 in sheep Cx50 ...
-
No products found
because this supplier's products are not listed.
Ayan Rajgarhia, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... cells were then treated with either an anti-5’ methylcytidine (5MeC) monoclonal antibody (Epigentek, Catalog No. A-1014), or non-specific IgG1 (BD Biosciences ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Mariel Fulham, et al.,
bioRxiv - Microbiology 2021
Quote:
... 458/459/JL-D2) in TBE (Tris, boric acid, ethylenediaminetetraacetic acid) and product size approximated using HyperLadderII 50bp DNA marker (Bioline, Sydney, Australia).
-
No products found
because this supplier's products are not listed.
Megan Chamberland, Brian Farrell, Johannes Yeh,
bioRxiv - Cell Biology 2022
Quote:
... 2 μm carboxylic acid functionalized silica spheres (Bangs Laboratory) were functionalized with octadecylamine (Sigma ...
-
No products found
because this supplier's products are not listed.
Hirdesh Kumar, et al.,
bioRxiv - Microbiology 2022
Quote:
... Customized phosphatidic acid (PA) membrane strips (Echelon Biosciences Inc.) containing a concentration gradient of PA from 400-0 pmol (400 pmol ...
-
No products found
because this supplier's products are not listed.
Chun-Yang Li, et al.,
bioRxiv - Neuroscience 2023
Quote:
... brain slices were rinsed 3 times in PBS (5 min each) and then were incubated in fluorochrome-conjugated secondary antibody (1:200, Dylight488-conjugated goat anti-rabbit Abbkine; 1:200 ...
-
No products found
because this supplier's products are not listed.
Oksana Tsyklauri, et al.,
bioRxiv - Genetics 2020
Quote:
4-hydroxy-3-nitrophenylacetic acid succinimide ester (LGC, Biosearch Technologies)
-
No products found
because this supplier's products are not listed.
Rutger Luteijn, et al.,
bioRxiv - Immunology 2019
Quote:
... Membranes were probed in 5% Bovine Serum Albumin (Fisher) in 1 X TBS-T with anti-SLC19A1 Picoband antibody (Boster Bio).
-
No products found
because this supplier's products are not listed.
VG LeBlanc, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... 1-100 ng of total nucleic acid was sonicated (Covaris LE220) in 62 µL volume to 250-350 bp ...
-
No products found
because this supplier's products are not listed.
Rita Gil, Mafalda Valente, Noam Shemesh,
bioRxiv - Neuroscience 2023
Quote:
... The acid was injected using a Nanojet II (Drummond Scientific Company). Animals were anesthetized with isoflurane (anesthesia induced at 5% concentration and maintenance below 3%) ...
-
No products found
because this supplier's products are not listed.
Akito Otubo, et al.,
bioRxiv - Neuroscience 2021
Quote:
... and/or a goat antibody against guinea pig IgG conjugated to 5 nm gold particles (1:50 dilution, Nanoprobes, Yaphank, NY, USA) for 1 hour at room temperature ...
-
No products found
because this supplier's products are not listed.
Leah Cuthbertson, et al.,
bioRxiv - Microbiology 2022
Quote:
... holo (human) (10 μg/ml) & retinoic acid (0.1 ng/ml) (Promocell, Germany) and Primocin (Invivogen ...
-
No products found
because this supplier's products are not listed.
Colins O. Oduma, et al.,
bioRxiv - Microbiology 2020
Quote:
... RNA was extracted using the pathogen Nucleic Acid Extraction kit (Macherey-Nagel, Düren, Germany) and eluted in 50 μL elution buffer ...
-
No products found
because this supplier's products are not listed.
Anne Bourdais, Benoit Dehapiot, Guillaume Halet,
bioRxiv - Cell Biology 2021
Quote:
... then individually transferred into small (5 µl) drops of fixative (5:1:4 of methanol:acetic acid:water) on a glass-bottom dish (Mattek). After the zona pellucida had gradually dissolved ...
-
No products found
because this supplier's products are not listed.
Desingu Ayyappa Raja, et al.,
bioRxiv - Developmental Biology 2019
Quote:
... at 5% CO2 (Eppendorf® New Brunswick Galaxy170S). Media was changed every day and cells were passaged upon reaching 80% confluence ...
-
No products found
because this supplier's products are not listed.
MR Melo, et al.,
bioRxiv - Neuroscience 2022
Quote:
... the multi-lead electrode pedestal was connected to an amplifier (10 Hz-5 KHz band-pass filter, 5 kHz sampling rate, Model 1700 Differential AC amplifier, A-M systems, Sequim, WA, USA). The signal was recorded and integrated using Spike2 version 9.0 software (Cambridge Electronic Design).