-
No products found
because this supplier's products are not listed.
Kévin Leguay, et al.,
bioRxiv - Cell Biology 2021
Quote:
... In vitro kinase assays were performed in 384-well low volume plates (Greiner #784075) in 5µl reaction volume ...
-
No products found
because this supplier's products are not listed.
Fatima Amanat, et al.,
bioRxiv - Microbiology 2022
Quote:
... proteins from Sino Biologicals (with no trimerization domain) were purchased and used ...
-
No products found
because this supplier's products are not listed.
Luciana Cañonero, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... and anti-Pyk1 (Polyclonal anti-pyruvate kinase (rabbit muscle) from Rockland) antibodies ...
-
No products found
because this supplier's products are not listed.
Zuye Fang, et al.,
bioRxiv - Microbiology 2022
Quote:
ATP levels and pyruvate kinase activity were determined with the ATP Assay Kit (Beyotime, S0026) and Pyruvate Assay Kit (Solarbio, BC2205), respectively ...
-
No products found
because this supplier's products are not listed.
Mallory Genest, et al.,
bioRxiv - Cell Biology 2021
Quote:
... Lysates were then incubated with 30 µg of Ras-GTP Binding Domain (RBD of human c-Raf kinase) fused with GST associated with beads (#RF02, Cytoskeleton) at 4°C for 1h ...
-
No products found
because this supplier's products are not listed.
Hugo Belda, et al.,
bioRxiv - Microbiology 2024
Quote:
... 3µl kinase at 40nM in kinase reaction buffer (20mM MOPS, 10mM magnesium chloride and 10mM manganese chloride, pH 7.4, Alfa Aesar) was dispensed in each well using a Multidrop™ Combi Reagent dispenser (ThermoFischer Scientific) ...
-
No products found
because this supplier's products are not listed.
Junzuo Liao, et al.,
bioRxiv - Developmental Biology 2019
Quote:
... large tumor suppressor kinase 1 (LATS1) (1:300, Proteintech), phosphorylated (p)-YAP (1:1,000 ...
-
No products found
because this supplier's products are not listed.
Na Xiao, et al.,
bioRxiv - Cell Biology 2021
Quote:
... anti-PI3 kinase p85 (1:200, bs-0128r, Bioss), anti-phospho-PI3 kinase p85 (Tyr458)/p55 (Tyr199 ...
-
No products found
because this supplier's products are not listed.
Jiangtao Liang, et al.,
bioRxiv - Evolutionary Biology 2024
Quote:
... and treated with T4 Polynucleotide Kinase (Sibenzyme, Novosibirsk, Russia). pBluescript SK (+ ...
-
No products found
because this supplier's products are not listed.
Bao V. Nguyen, et al.,
bioRxiv - Biochemistry 2024
Quote:
Kinase activity was monitored by Synergy H1 microplate reader (BioTek) at 30 °C as previously described with minor modifications (Stratton et al. ...
-
No products found
because this supplier's products are not listed.
Elad Horwitz, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... A custom library of kinase inhibitors was purchased from TargetMol. Cell counts for long term viability assays were carried using CellDrop (Denovix ...
-
No products found
because this supplier's products are not listed.
Nathaniel Kastan, et al.,
bioRxiv - Developmental Biology 2020
Quote:
The in vitro kinase assay (HTRF KinEASE-STK S1, CisBio 62ST1PEB) was optimized to the linear reaction range of the enzymes Lats1 (Carna 01 −123 ...
-
No products found
because this supplier's products are not listed.
Kathryn A. Swanson, et al.,
bioRxiv - Neuroscience 2023
Quote:
... p38 mitogen-activated protein kinase (p38MAPK, mouse, 1:2000, Biolegend 602651), and phosphorylated-p38MAPK (phospho-p38MAPK ...
-
No products found
because this supplier's products are not listed.
Françoise Gondois-Rey, et al.,
bioRxiv - Immunology 2022
Quote:
... a cell-binding domain adhesive peptide was used at 10 µM (Eurogentec).
-
No products found
because this supplier's products are not listed.
Iyan Warren, et al.,
bioRxiv - Bioengineering 2022
Quote:
... was purchased from Cayman Chemical (Ann Arbor, MI). Rho-associated kinase (ROCK) inhibitor (Y27632 2, Cat. #: MBS577605) was purchased from Mybiosource.com ...
-
No products found
because this supplier's products are not listed.
Avishek Ghosh, et al.,
bioRxiv - Cell Biology 2022
Quote:
... 50 µl of 2× kinase buffer containing 80 µM O18 ATP (OLM-7858-PK, Cambridge Isotope laboratories, Inc) and 1 µg of bacterial purified human PIP4Kα-GST was added and the reaction was incubated at 30 °C for 1 hour ...
-
No products found
because this supplier's products are not listed.
R.D. Metcalfe, J.A. Martinez Fiesco, P. Zhang,
bioRxiv - Molecular Biology 2022
Quote:
... The kinase reaction was carried out at 30 °C for thirty minutes with shaking (300 rpm) in a Thermomixer (Eppendorf). The reaction was stopped by addition of 5 μL of 4X SDS-PAGE loading buffer [250 mM Tris ...
-
No products found
because this supplier's products are not listed.
Kirsten L. Viola, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Aβ1-42 (American Peptide or Peptides International) or FAM-Aβ1-42 (Anaspec ...
-
No products found
because this supplier's products are not listed.
Kwadwo A. Opoku-Nsiah, et al.,
bioRxiv - Biochemistry 2021
Quote:
Peptides were synthesized by Fmoc solid phase peptide synthesis on a Syro II peptide synthesizer (Biotage) at ambient temperature and atmosphere on a 12.5 μM using either pre-loaded Wang resin or Rink amide resin (Sigma-Aldrich) ...
-
No products found
because this supplier's products are not listed.
Susanne Hellmuth, Olaf Stemmann,
bioRxiv - Cell Biology 2024
Quote:
... antigenic peptides (Bachem) were coupled via terminal Cys to Maleimide activated KLH (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Dyonne Y. Vos, et al.,
bioRxiv - Molecular Biology 2023
Quote:
Lipidomic analysis of liver samples was performed using the Lipidyzer™ Platform (SCIEX, Framingham, MA, USA), as previously described (34).
-
No products found
because this supplier's products are not listed.
Makenna M. Morck, et al.,
bioRxiv - Biochemistry 2021
Quote:
... 500 U/mL pyruvate kinase (product #500-20, Lee Biosolutions, Maryland Heights, MO, USA), 2.5 mM phospho(enol ...
-
No products found
because this supplier's products are not listed.
I.R. Akberdin, et al.,
bioRxiv - Systems Biology 2021
Quote:
... Another target of calmodulin is Ca2+/calmodulin-dependent protein kinase kinase 2 (CAMKK2) that phosphorylates AMPK Thr172 thereby activating the kinase (Abbott et al., 2009). In turn ...
-
Pyruvate Kinase Assay Kit
Cat# EPRK-100,
1.0 kit, 100 tests, USD $409.0
Ask
Daniel N. El Kodsi, et al.,
bioRxiv - Neuroscience 2020
Quote:
The EnzyChrom Creatine Kinase Assay Kit (BioAssay Systems) was applied to measure creatine kinase activity in mitochondria purified from wild type and parkin knock-out mouse brains following the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Ting-Yu Lin, et al.,
bioRxiv - Physiology 2022
Quote:
... Recombinant kinase WEE1 was purchased from BPS Biosciences. Recombinant PIK3CG was purchased from Thermo Fisher.
-
No products found
because this supplier's products are not listed.
Jeong Min Lee, et al.,
bioRxiv - Biochemistry 2024
Quote:
... FMS-like Tyrosine Kinase 3 Ligand (Flt3L, 100 ng/ml) (CellGenix, 1415-050) and Thrombopoietin (TPO ...
-
No products found
because this supplier's products are not listed.
Caila A. Pilo, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Lipids used in kinase assays (DG, cat #800811C and PS, cat #840034C) were purchased from Avanti Polar Lipids. The anti-phospho-PKCγ hydrophobic motif (pThr674 ...
-
No products found
because this supplier's products are not listed.
Piotr Gawroński, et al.,
bioRxiv - Plant Biology 2020
Quote:
... The 16 to 42-nt fraction was isolated by electrophoresis and treated with T4 polynucleotide kinase before library preparation using the TruSeq Small RNA Library Preparation Kit (Illumina). Sequencing was performed on the HiSeq 4000 platform (Illumina).
-
No products found
because this supplier's products are not listed.
Zhaoqian Wang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
No products found
because this supplier's products are not listed.
Shih-Chia Yeh, et al.,
bioRxiv - Zoology 2022
Quote:
... and liver powder (MP Biomedicals). Adult mosquitoes were maintained in a 30×30×30 cm cage (Bioquip ...
-
No products found
because this supplier's products are not listed.
Swetha K. Godavarthi, et al.,
bioRxiv - Neuroscience 2023
Quote:
... VGAT (1:300, cytoplasmic domain, Synaptic Systems, 131013), GFP (1:500 ...
-
No products found
because this supplier's products are not listed.
Anastassia Mikhailova, et al.,
bioRxiv - Microbiology 2020
Quote:
Peptides (Proteogenix) were received as dry powder and reconstituted with water for use ...
-
No products found
because this supplier's products are not listed.
Megan E. McNamara, et al.,
bioRxiv - Molecular Biology 2024
Quote:
ATAC-seq libraries were generated from liver sinusoidal endothelial (LSEC) and liver-resident immune cryopreserved cells using the ATAC-seq kit (Active Motif). H3K27ac histone modification data was generated from liver sinusoidal endothelial (LSEC ...
-
No products found
because this supplier's products are not listed.
Jakob Berner, et al.,
bioRxiv - Cell Biology 2022
Quote:
... 1 mM sodium pyruvate (Pan Biotech), 25 mM HEPES (Pan Biotech) ...
-
No products found
because this supplier's products are not listed.
Sujeethkumar Prithiviraj, et al.,
bioRxiv - Bioengineering 2024
Quote:
... 1% sodium pyruvate (100 × 10-3M) and 1% penicillin-streptomycin-glutamine solution (100X) ...
-
No products found
because this supplier's products are not listed.
Alessio Vittorio Colombo, et al.,
bioRxiv - Neuroscience 2020
Quote:
Synthetic Aβ40 peptide (rPeptide) was solubilized (1 mg/ml ...
-
No products found
because this supplier's products are not listed.
Lydia Angelopoulou, et al.,
bioRxiv - Molecular Biology 2023
Quote:
Liver gDNA was extracted using the NucleoSpin Tissue kit (Macherey-Nagel) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Marta Fontcuberta-PiSunyer, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... and C-peptide using a human C-peptide ELISA kit (Mercodia, Uppsala, Sweden).
-
No products found
because this supplier's products are not listed.
Ishan Goswami, et al.,
bioRxiv - Bioengineering 2022
Quote:
... C-peptide was measured via STELLUX Chemi Human C-peptide ELISA kit (Alpco). Stimulation index (SI ...
-
No products found
because this supplier's products are not listed.
Mateo Murillo-León, et al.,
bioRxiv - Immunology 2023
Quote:
... liver and brain were taken and preserved in DNA/RNA shield (Zymo Research) at −80°C until DNA/RNA isolation ...
-
No products found
because this supplier's products are not listed.
Chenlu Zhang, et al.,
bioRxiv - Systems Biology 2024
Quote:
... Peptide and probe-peptide adduct were separated on Gemini C18 column (Phenomenex, 5 µm, 50 x 4.6 mm) at a flow rate of 1 mL/min ...
-
No products found
because this supplier's products are not listed.
Matias Gutiérrez-González, et al.,
bioRxiv - Immunology 2021
Quote:
... Ig-derived peptides and influenza HA306-318-derived probe peptide Ac-PRYVKQNTLRLAT were synthesized (21st Century Biochemicals, Marlboro, MA). The probe peptide was labeled with Alexa Fluor 488 tetrafluorophenyl ester (Invitrogen ...
-
No products found
because this supplier's products are not listed.
Zhiqiang Fu, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Peptides were separated with PicoFrit columns (New Objective, 15 cm×75 μm ID ...
-
No products found
because this supplier's products are not listed.
Célie Cokelaere, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... peptides were desalted on Macro Spin Tips (Harvard Apparatus) before processing on Phos-TiO2 tips (GL Sciences ...
-
No products found
because this supplier's products are not listed.
S. John Liu, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... Peptides were desalted using MicroSpin Columns (The Nest Group) and resuspended in 4% formic acid and 3% acetonitrile ...
-
No products found
because this supplier's products are not listed.
Antigoni Gogolou, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... and Rho-Associated Coil Kinase (ROCK) inhibitor Y-27632 2HCl (10 μM, Adooq Biosciences) with the latter being withdrawn from the differentiation medium after the first day of NMP induction ...
-
No products found
because this supplier's products are not listed.
Kee-Beom Kim, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... The assay for ROCK1 kinase activity assay was performed according to the manufacturer’s protocol (Cell Biolabs, STA-415). Briefly ...
-
No products found
because this supplier's products are not listed.
Bjoern Traenkle, et al.,
bioRxiv - Immunology 2021
Quote:
... VHH domain (Jackson ImmunoResearch) was applied for 15 min ...
-
No products found
because this supplier's products are not listed.
Akesh Sinha, et al.,
bioRxiv - Immunology 2024
Quote:
... peptide (YPYDVPDYAGAGC) or N-terminally biotinylated HA peptide (Bio-HA) (GL Biochem Ltd., Shanghai, China) or HER2 extracellular domain (ECD) (Acrobiosystems, Newark, DE, USA) was used as antigen in ELISAs ...
-
No products found
Smrithi Rajendiran, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Liver was digested with collagenase type IV (Worthington) enzyme (1mg/mL ...