-
No products found
because this supplier's products are not listed.
Krishnapriya Hari, et al.,
bioRxiv - Neuroscience 2021
Quote:
... including anti-α5 GABAA receptor subunit (AAP34984, Aviva Systems Biology, San Diego, USA), anti-α1 GABAA receptor subunit (224-2P ...
-
No products found
because this supplier's products are not listed.
Stacia M. Nicholson, Francis A.X. Schanne,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... Fc receptors were blocked for 30 min with Protein A (MP Biomedicals, OH) in Stain Buffer (554656 ...
-
No products found
because this supplier's products are not listed.
Joshua D’Rozario, et al.,
bioRxiv - Immunology 2021
Quote:
Diphtheria toxin receptor (DTR) FAP+ DM2 mice received 25ng/g diphtheria toxin (List Biological Laboratories) i.p ...
-
No products found
because this supplier's products are not listed.
Yingying Chen, et al.,
bioRxiv - Neuroscience 2023
Quote:
... rabbit anti-immunoglobulin like domain containing receptor 1 (ILDR1) (Antibodies-online.com, 1:200, Cat # ABIN1386369), (6 ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and probed for expression of total MOR (rabbit anti-mu opioid receptor, Neuromics, RA10104, 1:500), P-ser375 MOR (rabbit anti-mu opioid receptor Ser375 ...
-
No products found
because this supplier's products are not listed.
Meng Zhang, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Fluorescence intensity of Tb3+-labelled receptors was measured on an Infinite M1000 fluorescence plate reader (Tecan) with an excitation wavelength of 340 nm and emission wavelength of 620 nm ...
-
No products found
because this supplier's products are not listed.
Shima Shahbaz, et al.,
bioRxiv - Immunology 2020
Quote:
... The SARS-CoV-19 spike receptor binding domain protein was purchased from VIROGEN (Cat#00224-V), conjugated with dye using Fluorescent protein labeling kit according to the manufacturing protocol (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Jaime A. Freire-Arvelo, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Optical density of D2 receptors of each sample was obtained using Odyssey software (LI-COR Biosciences), normalized against background ...
-
No products found
because this supplier's products are not listed.
O Bogen, et al.,
bioRxiv - Neuroscience 2024
Quote:
... psi ε receptor for activated C kinase (ψεRACK) (27) was purchased from Biomatik (Wilmington, DE, USA), and the proinflammatory cytokine prostaglandin-E2 (PGE2 ...
-
No products found
because this supplier's products are not listed.
Luana dos Santos Ortolan, et al.,
bioRxiv - Pathology 2019
Quote:
Soluble endothelial protein C receptor (sEPCR) was measured with an ELISA kit (Elabscience®, E-EL-M1073) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Nathan J. Dwarshuis, et al.,
bioRxiv - Bioengineering 2019
Quote:
The anti-CD19-CD8-CD137-CD3z chimeric antigen receptor with the EF1α promotor [28] was synthesized (Aldevron) and subcloned into a FUGW lentiviral transfer plasmid (Emory Viral Vector Core) ...
-
No products found
because this supplier's products are not listed.
Maria Hauge Pedersen, et al.,
bioRxiv - Cell Biology 2020
Quote:
... The human μ/κ/d/Nociceptin opioid receptors were all inserted into the pMEX2 vector from Multispan.
-
No products found
because this supplier's products are not listed.
Agnès Roure, Rafath Chowdhury, Sébastien Darras,
bioRxiv - Developmental Biology 2022
Quote:
... or 2.5 μM of the BMP receptor inhibitor DMH1 (S7146, Euromedex, 10 mM stock solution in DMSO) at the stages indicated in the text and figures ...
-
No products found
because this supplier's products are not listed.
Kateřina Štepánková, et al.,
bioRxiv - Neuroscience 2023
Quote:
... 5HT receptor and synapsin staining was imaged with confocal microscope Olympus FV10i (Olympus Life Science, Waltham, MA, USA). The intensity of 5HT and synapsin was measured in the ventral horn by ImageJ™ and compared between 4-MU-treated and placebo group ...
-
No products found
because this supplier's products are not listed.
Chirag H Patel, et al.,
bioRxiv - Immunology 2023
Quote:
... containing chimeric antigen receptor (CAR) was made using Platinum-E (Plat-E) Retroviral Packaging Cell Line (Cell Biolabs). Fresh virus with human IL-2 was spin fected onto retronectin coated plates according to protocol (33156338) ...
-
No products found
Martha Paluschinski, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... cells were administrated with 10 µM of the TGFβ receptor-I inhibitor SB431542 (Axon Medchem LLC, Groningen, Netherlands) and incubated for 3 hours before addition of TGFβ1.
-
No products found
because this supplier's products are not listed.
Yue Han, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Vesicles containing transferrin receptor were imaged using an sCMOS camera through a CFI Apo 60× 1.49 objective (Nikon) on a Ti2 microscope (Nikon) ...
-
No products found
because this supplier's products are not listed.
Martineau Éric, et al.,
bioRxiv - Neuroscience 2020
Quote:
... postsynaptic nicotinic receptors (nAChRs) were labeled using α-Bungarotoxin (BTX) conjugated with CF405 (4 μg/mL; Biotium; cat ##00002) for 45 min in PBS ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
LC Laboratories' Product Number G-5903 - GW2580, Free Base (cFMS Receptor Tyrosine Kinase...
Cat# G-5903, SKU# G-5903_10g,
10 g, $2670.00
Ask
Sehar Ali, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... VEGFR2 tyrosine kinase inhibitor (Vatalanib) and colony stimulating factor 1 receptor (CSF1R) inhibitor (GW2580) were purchased from LC Laboratories, Woburn ...
-
No products found
because this supplier's products are not listed.
Angela Kim, et al.,
bioRxiv - Cell Biology 2021
Quote:
... was from Tocris (Bio-Techne Ltd, UK). The glucagon receptor antagonist LY2409021 (adomeglivant; Kazda, et al. (30)) was from MedKoo Biosciences (USA).
-
No products found
because this supplier's products are not listed.
Saurabh Srivastava, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The optimal receptor-binding domain (OBD) (100, 100) of Tetanus Toxin (Heavy Chain/B Subunit) was synthesized by GENEWIZ (incorporating flanking 5’ Hindlll and 3’ Nco1 restriction sites ...
-
Cat# AB-N14,
100 micrograms,USD $325.0
Ask
Lidia I. Madrid, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Infusion of murine-p75 neurotrophin receptor (p75NTR)-Saporin (hereafter abbreviated as p75-Sap; 0.4 µg/µl; Advanced Targeting System) or control rabbit-IgG-Saporin (IgG-Sap ...
-
No products found
because this supplier's products are not listed.
Rachael Kuintzle, et al.,
bioRxiv - Systems Biology 2023
Quote:
... All of the Notch receptor piggyBac constructs were derived from the vector PB-CMV-MCS-EF1-Puro (System Biosciences), with changes made to the promoter (CMV changed to PGK or CAG ...
-
shRNA Plasmid to inhibit IGF1 expression by RNA interference. This product contains 3 separate...
Cat# abx970985-150UG,
150 µg USD $783.0
Ask
Michaela Frolikova, et al.,
bioRxiv - Cell Biology 2023
Quote:
... diluted 1:50 in 1% BSA in PBS and rabbit polyclonal anti-Folate receptor 4 (Juno) (abx102438, Abbexa, UK) diluted 1:50 in 1% BSA in PBS followed by 1 hr ...
-
No products found
because this supplier's products are not listed.
N.D. Maxwell, et al.,
bioRxiv - Neuroscience 2023
Quote:
... CA) using probes against the leptin receptor mRNA (Cat# 415951) and Opal 650 dye kit (Akoya Biosciences, Marlborough, MA) to label LepR mRNA ...
-
No products found
because this supplier's products are not listed.
Joseph de Rutte, et al.,
bioRxiv - Bioengineering 2021
Quote:
... antibody atezolizumab and the anti-interleukin 8 receptor beta (IL-8Rb) antibody 10H2 were cloned into the gwiz mammalian expression vector (Genlantis) and used for transient transfection of HEK 293T cells loaded into nanovials ...
-
No products found
because this supplier's products are not listed.
Mei Lin, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and the PH domains from phospholipase C-δ1 (PLCδ-PH) and general receptor for phosphoinositides (GRP1-PH) were constructed by cloning PCR-amplified cDNA into pET-SUMO vector (LifeSensors), in frame with the N-terminal 6His-SUMO tag ...
-
No products found
because this supplier's products are not listed.
Shuiyun Lan, et al.,
bioRxiv - Microbiology 2021
Quote:
... A chimeric neutralizing antibody specific against SARS-CoV-2 S protein receptor binding domain (NR-55410) was provided by ACROBiosystems through BEI resources.
-
No products found
because this supplier's products are not listed.
Assaf Alon, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
Purified σ2 receptor was reconstituted into lipidic cubic phase (LCP) by mixing with a 10:1 (w:w) mix of monoolein (Hampton Research) with cholesterol (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Melissa Govender, et al.,
bioRxiv - Immunology 2022
Quote:
... including anti-spike neutralizing IgG antibodies directed against the receptor binding domain (RBD) of S1 subunit was performed using a commercial chemiluminescent microparticle-based immune assay (Abbott SARS-CoV-2 IgG II Quant/6S60 ARCHITECT SARS-CoV-2 IgG kit ...
-
No products found
because this supplier's products are not listed.
Krishna K. Narayanan, et al.,
bioRxiv - Microbiology 2023
Quote:
... The eluted proteins were concentrated with a centrifugal device (MWCO 30 kDa for soluble EFNB2 proteins and 50 kDa for soluble Eph receptor proteins; Sartorius) before being separated on a Superdex 200 Increase 10/300 GL (Cytiva Life Sciences ...
-
No products found
because this supplier's products are not listed.
Carolyn Rydyznski Moderbacher, et al.,
bioRxiv - Immunology 2022
Quote:
... the hACE2 receptor bound to the S protein was then detected using a mouse anti-His-Tag horseradish peroxidase conjugate (Southern Biotech) and a colorimetric signal generated by the addition of 3,3′,5,5′-TMB substrate ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Renée M. van der Sluis, et al.,
bioRxiv - Immunology 2021
Quote:
... antibodies blocking the type I IFN receptor (mouse anti-human IFNAR2 antibody, clone MMHAR-2, PBL Assay Science Cat#21385-1) or isotype control (Ultra-LEAF Purified mouse IgG2a ...
-
No products found
because this supplier's products are not listed.
Ryouhei Tsutsumi, et al.,
bioRxiv - Cell Biology 2023
Quote:
... EGFP-conjugated GLUT1 ligand (receptor binding domain of the human T cell leukemiavirus (HTLV) envelope glycoprotein) was purchased from Metafora Biosystems.
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
... Antibodies were added to each sample (0.5μg of rabbit glucocorticoid receptor antibody [abcam, ab225886, 1:20] or rabbit IgG negative control antibody [Epicypher, 13-0041k, 1:50]). The remaining steps were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Sarah M Pearsall, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... and subcutaneously implanted into the flank of 8-16-week-old non-obese diabetic (NOD) severe combined immunodeficient (SCID) interleukin-2 receptor γ– deficient (NSG) mice (Charles River). CDX models were generated from patients’ CTCs enriched from blood samples at pre-chemotherapy baseline and/or at post-treatment disease progression time-points (designated P ...
-
No products found
because this supplier's products are not listed.
Yue Wang, et al.,
bioRxiv - Biophysics 2021
Quote:
... 3 μl of purified ghrelin-bound complex at 13 mg/ml and GHRP-6-bound ghrelin receptor complex at 8 mg/ml were applied individually onto a glow-discharged holey carbon grid (Quantifoil, Au300 R1.2/1.3) in a Vitrobot chamber (FEI Vitrobot Mark IV) ...
-
No products found
because this supplier's products are not listed.
Susanne N. Walker, et al.,
bioRxiv - Immunology 2020
Quote:
... Followed by capture of SARS-CoV-2 receptor binding domain which was biotinylated using the lightning-link type-A biotinylation kit(Expedeon/Abcam, 370-0005) for 180s at 10ul/min ...
-
No products found
because this supplier's products are not listed.
Angela M. Bosco-Lauth, et al.,
bioRxiv - Microbiology 2020
Quote:
... Positive control antibodies to the receptor-binding domain (RBD) and full-length spike protein were human MAb CR3022 antibody (Absolute Antibody, Oxford UK) and human IgG whole molecule (Jackson Immuno Research ...
-
No products found
because this supplier's products are not listed.
Julius Jonaitis, et al.,
bioRxiv - Neuroscience 2023
Quote:
Pharmacological agents and their concentrations used in this study: 5-HT receptor agonist (10-5M serotonin hydrochloride, TCI Chemicals, CAS:153-98-0) was made fresh every day before the start of experiments and the aliquot was shielded from light ...
-
No products found
because this supplier's products are not listed.
Jinghan Tan, Susanne Neupert, Jean-Paul Paluzzi,
bioRxiv - Zoology 2024
Quote:
... These amplified products were then purified as above and restriction enzyme digested CCHa1R and CCHa2R sequences were ligated into pcDNA3.1+ and pBudCE4.1 mammalian expression vectors followed by bacterial transformation and plasmid DNA purification to obtain a large quantity of receptor constructs using ZymoPURE II Plasmid Midiprep Kit (Zymo Research, Tustin, CA, USA) following the manufacturer recommendation ...
-
No products found
because this supplier's products are not listed.
Szymon P. Kordon, et al.,
bioRxiv - Biochemistry 2024
Quote:
Purified receptor was diluted to ∼5 ug mL−1 and applied to freshly glow-discharged EM carbon coated copper grid (Electron Microscopy Sciences, CF400-Cu,) for 30 sec ...
-
No products found
because this supplier's products are not listed.
MT Heemskerk, et al.,
bioRxiv - Immunology 2021
Quote:
... diluted in PBS for 10 min at RT and Fc-receptors were subsequently blocked using 5% human serum (HS; Sanquin Blood bank, Amsterdam, The Netherlands) for 45 min at RT ...
-
Rabbit polyclonal antibody to IGF1 Receptor
Cat# CPA1579,
200 ul USD $350.0, 100 ul USD $220.0, 30 ul USD $110.0
No citation found on bioRxiv
-
The IGF1 ORF Vector holds the gene (cloned by a restriction enzyme-independent method) between...
Cat# 2431201.0,
1.0 μg DNA, NM_000618; 1.0 μg DNA, NM_001111274; 1.0 μg DNA, NM_184052; 1.0 μg DNA, NM_001082477; 1.0 μg DNA, NM_178866, Inquire
No citation found on bioRxiv
-
Cat# NSC1129,
Customizable size, Inquiry
No citation found on bioRxiv
-
The insulin-like growth factors (IGFs) belonged to the insulin gene family, are mitogenic...
Cat# IGF1-06H,
100ug : USD $87, 1mg : USD $270
No citation found on bioRxiv
-
IGF1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence...
Cat# CPILF22644,
inquiry, contact supplier for pricing
No citation found on bioRxiv