-
No products found
because this supplier's products are not listed.
Nicholas J Swanson, et al.,
bioRxiv - Microbiology 2023
Quote:
... Lyophilized Receptor Destroying Enzyme II (RDE, Hardy Diagnostics) was dissolved into 20 mL of saline (0.9% NaCl in H2O ...
-
No products found
because this supplier's products are not listed.
Miles H. Black, et al.,
bioRxiv - Biochemistry 2020
Quote:
... and 50 μM 6-biotin-17-NAD+ (Trevigen). Reactions were incubated at 37 °C for 15 minutes ...
-
No products found
because this supplier's products are not listed.
S. Jake Gonzales, et al.,
bioRxiv - Immunology 2021
Quote:
... hypoxanthine (17 µg/ml; Alfa Aesar #A11481-06), L-glutamine (2.1 mM ...
-
No products found
because this supplier's products are not listed.
Thomas Kimman, et al.,
bioRxiv - Immunology 2024
Quote:
... was added and for primary MM the medium was supplemented with 100 ng/ml human recombinant IL-6 (Tebu Bio) and 100 ng/ml human recombinant APRIL/TNFSF-13 (R&D systems) ...
-
No products found
because this supplier's products are not listed.
Bo Liang, et al.,
bioRxiv - Microbiology 2020
Quote:
... ethanol (CAS 64-17-5) (Spectrum Chemicals, New Brunswick, NJ) was used as supplied ...
-
No products found
because this supplier's products are not listed.
Arjit Vijey Jeyachandran, et al.,
bioRxiv - Microbiology 2023
Quote:
... a mixture of 70 lipid standards across 17 subclasses (AB Sciex 5040156 ...
-
No products found
because this supplier's products are not listed.
Behnam Nabet, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... 17 and immunoblotting was performed using an Odyssey CLx Imager (LI-COR) as previously described.6 ...
-
No products found
because this supplier's products are not listed.
Jonathan R Baker, et al.,
bioRxiv - Cell Biology 2021
Quote:
... IL-36γ and IL-36RA were quantified using commercially available ELISA kits (AdipoGen life sciences, Epalinges, Switzerland); The lower limit of detection for these assays were 3.9 pg/ml (IL-36γ ...
-
No products found
because this supplier's products are not listed.
Logan T. Blancett, et al.,
bioRxiv - Microbiology 2023
Quote:
... Fc receptors were blocked for 10 minutes with CD32/CD16 mAb (Leinco Technologies, Inc.). Cells were incubated with Zombie UV™ Fixable Viability Dye (BioLegend ...
-
No products found
because this supplier's products are not listed.
Ryann M. Fame, et al.,
bioRxiv - Neuroscience 2023
Quote:
... and isotopically labeled 17 amino acids (at 1/5000, Cambridge Isotope Laboratories, MSK-A2-1.2) and isotopically labeled reduced glutathione (at 1 μM ...
-
No products found
because this supplier's products are not listed.
Rory Henderson, et al.,
bioRxiv - Immunology 2023
Quote:
... The synthetic Toll-like receptor 7/8 agonist 3M-052 absorbed to ALUM (3M-052-ALUM) was used as the adjuvant for the vaccine immunogens ...
-
No products found
because this supplier's products are not listed.
Laurence Cromer, et al.,
bioRxiv - Cell Biology 2019
Quote:
... homozygous pans1-1 seeds were incubated for 17 h at room temperature in 5 mL of 0.3% (v/v) ethyl methanesulfonate (EMS) (SIGMA ...
-
No products found
because this supplier's products are not listed.
S Momsen Reincke, et al.,
bioRxiv - Immunology 2021
Quote:
... Human mAbs were applied and detected using HRP-conjugated anti-human IgG (Dianova, 709-035-149) and the HRP substrate 1-step Ultra TMB (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Katharina Hoette, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Isolation of organoids from the embedding matrix (human hepatic organoids: Matrigel, Corning; human pancreatic organoids: Cultrex BME2, Amsbio) for fixation and whole-mount staining was performed with slight modifications of protocols published by Broutier et al ...
-
No products found
because this supplier's products are not listed.
Maciej Kliszczak, et al.,
bioRxiv - Cell Biology 2023
Quote:
... rabbit anti-human FAM111B (HPA038637, Atlas Antibodies) at 1:1000 (IB and IF) ...
-
No products found
because this supplier's products are not listed.
Nicholas B. Karabin, et al.,
bioRxiv - Bioengineering 2020
Quote:
... Pooled human plasma was acquired from Zen-Bio Inc ...
-
No products found
because this supplier's products are not listed.
Mee-Rye Park, et al.,
bioRxiv - Systems Biology 2020
Quote:
... ribosomal RNA (rRNA) was removed using the Ribo-Zero Magnetic Kit for bacteria (Epicentre, IL). Metatranscriptome library preparation was performed using the Ion Total RNA-Seq Kit v2 (Life Technologies ...
-
No products found
because this supplier's products are not listed.
Jiao Wang, et al.,
bioRxiv - Immunology 2020
Quote:
... Recombinant human interleukin-12 (IL-2) was gifted from Akron Biotech. Recombinant human interleukin-15 (IL-15 ...
-
No products found
because this supplier's products are not listed.
Rafaela Schober, et al.,
bioRxiv - Immunology 2022
Quote:
... The pcDNA3.1 vector coding for human IL-15 was synthesized by ProteoGenix SAS (Strasbourg ...
-
No products found
because this supplier's products are not listed.
Phaedra Winstanley-Zarach, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... control human articular cartilage tissue was obtained from Articular Engineering (Northbrook, IL). Six cartilage samples from each group were analysed and all were obtained from male donors ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Yunqian Peng, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... proinsulin (HyTest Ltd., 2PR8, CCI-17). Secondary antibodies were used in 1:5000 (Li-Cor ...
-
No products found
because this supplier's products are not listed.
Ryu J. Iwatate, et al.,
bioRxiv - Cell Biology 2020
Quote:
... ES9-17 (Carbosynth, CA; cat# BE17203) was dissolved in DMSO at a concentration of 50 mM and stored in glass vial at −30 ºC ...
-
No products found
because this supplier's products are not listed.
Ryan S. Nett, et al.,
bioRxiv - Biochemistry 2022
Quote:
... huperzine A (17, ApexBio Technology LLC).
-
No products found
because this supplier's products are not listed.
Michael J. Robertson, et al.,
bioRxiv - Biophysics 2022
Quote:
All receptors were expressed in Sf9 insect cells (Expression Systems) infected at a density of 3-4 million cells/ml ...
-
No products found
because this supplier's products are not listed.
Riki Kawamura, Masato Nikaido,
bioRxiv - Neuroscience 2022
Quote:
... dehydroepiandrosterone 3-sulfate (DHEA-s), β-estradiol 17-(β-D-glucuronide) (E2-17g), and β-estradiol 3,17-disulfate (E2-3, 17s) were respectively purchased from Tokyo Chemical Industry, Cayman Chemical Co. ...
-
No products found
because this supplier's products are not listed.
Hayley R. Moore, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... D-luciferin (Biosynth, Naperville, IL) was added to a final concentration of 150 μg/mL ...
-
No products found
because this supplier's products are not listed.
Olga Ponomarchuk, et al.,
bioRxiv - Cell Biology 2024
Quote:
... and cultured in CnT-17 medium (CellnTec Advanced Cell Systems, Bern, CH) until 80% confluence was reached ...
-
No products found
because this supplier's products are not listed.
Krishnapriya Hari, et al.,
bioRxiv - Neuroscience 2021
Quote:
... including anti-α5 GABAA receptor subunit (AAP34984, Aviva Systems Biology, San Diego, USA), anti-α1 GABAA receptor subunit (224-2P ...
-
No products found
because this supplier's products are not listed.
Andrea Corno, et al.,
bioRxiv - Cell Biology 2022
Quote:
... 14 and 17) were generated by inserting synthesized DNA fragments (Bio Basic Inc) in the backbone pcDNA5-YFP-KNL1WT at restriction sites XmaI/Bsu36I and XhoI/BbvCI ...
-
No products found
because this supplier's products are not listed.
Michel Thépaut, et al.,
bioRxiv - Immunology 2020
Quote:
Baby hamster kidney cells (BHK-21, 12-14-17 MAW, Kerafast, Boston, MA) and African Green Monkey Cell Line (VeroE6 ...
-
No products found
because this supplier's products are not listed.
Roberto Vargas, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... were measured using a Synergy H1 (Biotek, IL) luminescence plate reader ...
-
No products found
because this supplier's products are not listed.
Einat Bigelman, et al.,
bioRxiv - Cell Biology 2022
Quote:
... which recognizes the native form of the extracellular portion of the receptor (Biorbyt, England, clone orb399781) followed by flow cytometry analysis.
-
No products found
because this supplier's products are not listed.
Hanyu Pan, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Yang.17 The PD-1 blocking scFv E27 gene was synthesized by GENEWIZ (GENEWIZ, Suzhou, China) according to the previous report.36 3BNC117 CAR and E27 were cloned into a lentiviral vector (pTRPE-GFP-T2A-mRFP ...
-
This Fibronectin solution has been purified from human plasma where it is found as a dimer and...
Cat# 5050-1MG,
1 mg, USD $135.0
Ask
Ines A Cadena, et al.,
bioRxiv - Bioengineering 2024
Quote:
... and we used lithium pheny-2,4,6-trimethylbenzoylphosphinate (LAP) as a photoinitiator (17 mg/mL, Advanced Biomatrix), as it has been reported to improve cell viability compared to irgacure.(22,23 ...
-
No products found
because this supplier's products are not listed.
Jan Steinkühler, et al.,
bioRxiv - Biophysics 2020
Quote:
... Human Transferrin – CF488A (Biotium) at 130 nM ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
Interleukin-17 A/F Heterodimer Protein is a recombinant cytokine.
Cat# abx263114-10UG,
10 µg USD $377.0
Ask
Michaela Frolikova, et al.,
bioRxiv - Cell Biology 2023
Quote:
... diluted 1:50 in 1% BSA in PBS and rabbit polyclonal anti-Folate receptor 4 (Juno) (abx102438, Abbexa, UK) diluted 1:50 in 1% BSA in PBS followed by 1 hr ...
-
No products found
because this supplier's products are not listed.
Balaji Karthick Subramanian, et al.,
bioRxiv - Pathology 2019
Quote:
... Human primary podocytes from Celprogen Inc ...
-
No products found
because this supplier's products are not listed.
Mariana I. Tsap, et al.,
bioRxiv - Neuroscience 2023
Quote:
... A fused-silica capillary column Optima 17 (15 m length, 0.25 mm I.D., 0.25 µm film thickness) from Macherey-Nagel (Düren, Germany) was used ...
-
No products found
because this supplier's products are not listed.
Cathal Meehan, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Recombinant IL-6 with an N-terminal his tag (Fitzgerald, Biosynth Ltd.) was immobilized on His-Pur™ Ni-NTA Resin (ThermoScientific ...
-
The originally described IL-17 protein, now known as IL-17A, is a homodimer of two 132 amino...
Cat# IL17A-26H,
10 µg : USD $238
Ask
Noah R. Johnson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... recombinant human apoA-I (Creative Biomart), human plasma-derived apoE (Sigma) ...
-
No products found
because this supplier's products are not listed.
Manuel Göpferich, et al.,
bioRxiv - Neuroscience 2020
Quote:
... human FGF (20 ng/μl, ReliaTech) and human EGF (Promokine) ...
-
No products found
because this supplier's products are not listed.
Johannes Yayo, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Waters amino acid standard solution with 17 amino acids (cat. no. WAT088122) was mixed with glutamine (Irvine Scientific, Tilburg, The Netherlands), asparagine ...
-
No products found
because this supplier's products are not listed.
Sk. Kayum Alam, et al.,
bioRxiv - Cancer Biology 2022
Quote:
Human DARPP-32 isoforms purified from NSCLC cells were incubated with kinase-activated human IKKα protein (SignalChem) for in vitro kinase assays by following previously described methods70 ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
... Antibodies were added to each sample (0.5μg of rabbit glucocorticoid receptor antibody [abcam, ab225886, 1:20] or rabbit IgG negative control antibody [Epicypher, 13-0041k, 1:50]). The remaining steps were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Diego Gilioli, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... 10% Human Serum (cat#ECS0219D from Euroclone) and IL-2 (cat#F027131010 from Novartis ...
-
No products found
because this supplier's products are not listed.
V. Praveen Chakravarthi, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... 30 IU of human chorionic gonadotropin (hCG; BioVendor) was injected intraperitoneally ...
-
No products found
because this supplier's products are not listed.
José-María Díez, Carolina Romero, Rodrigo Gajardo,
bioRxiv - Immunology 2020
Quote:
... Human Anti-MERS-S2 IgG ELISA Kit (Alpha Diagnostic Intl. Inc.), against S2 subunit spike protein ...
-
No products found
because this supplier's products are not listed.
Qinghui Wang, et al.,
bioRxiv - Immunology 2022
Quote:
... Naïve CD3 human T cells were purchased from HemaCare (Lot #21068415). N/TERT-1 cells were a gift from the Rheinwald Lab (Dickson et al. ...