-
No products found
because this supplier's products are not listed.
Hanyuan Shen, et al.,
bioRxiv - Pharmacology and Toxicology 2019
Quote:
A431 cells were treated with different injections for 48 hours in 96-well plates and the cell culture supernatant was collected and tested for the level of IL-1β by ELISA using human interleukin-1 beta ELISA kit (Biosensis, CA, USA) according to the kit protocol ...
-
No products found
because this supplier's products are not listed.
Nikolaus Frischauf, et al.,
bioRxiv - Immunology 2024
Quote:
... In a regular 96 ELISA flat bottom plate 15% normal human serum (Sanquin, Amsterdam, The Netherlands) was added to the liposome mixture (R1 from the kit ...
-
No products found
because this supplier's products are not listed.
Joshua D. Powell, et al.,
bioRxiv - Microbiology 2024
Quote:
... ELISA (IDEXX) and HI assays were performed on serum from contact pigs at 17 dpc to determine if IAV-specific antibodies were present to indicate virus transmission.
-
No products found
because this supplier's products are not listed.
Saritha S. D’Souza, et al.,
bioRxiv - Cell Biology 2021
Quote:
... A p27 ELISA (Zeptometrix) was performed on each time point according to the manufacturer’s instructions to determine the amount of virus produced in each well.
-
No products found
because this supplier's products are not listed.
Miguel A. Olivencia, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
25-hydroxyvitamin D and testosterone levels were measured in rat citrated plasma and human EDTA plasma using a General 25-Hydroxyvitamin D3 (HVD3) ELISA Kit (Reddot Biotech Inc., Kelowna, Canada) and Testosterone ELISA DE1559 (Demeditec ...
-
No products found
because this supplier's products are not listed.
Wei-Ping Hu, et al.,
bioRxiv - Molecular Biology 2023
Quote:
Human BMPR2 ELISA Kit (orb406355, Biorbyt, United Kingdom) was used to detect the level of soluble BMPR2 in serum ...
-
No products found
because this supplier's products are not listed.
Verity J. Ford, et al.,
bioRxiv - Physiology 2024
Quote:
... Endogenous plasma catecholamine levels (epinephrine, norepinephrine, and dopamine) were determined using commercially available canine ELISA kits (Life Diagnostics, West Chester, PA). Further ...
-
No products found
because this supplier's products are not listed.
Nina Vesel, et al.,
bioRxiv - Microbiology 2023
Quote:
... and 2% agarose D3 (Euromedex, France ...
-
No products found
because this supplier's products are not listed.
Neeltje van Doremalen, et al.,
bioRxiv - Microbiology 2022
Quote:
... cells were transfected with 100 ng of human or rhesus ACE2 receptor plasmid DNA using polyethylenimine (Polysciences). After 24 h ...
-
No products found
because this supplier's products are not listed.
Hao Yan, et al.,
bioRxiv - Cell Biology 2024
Quote:
... ELISA kits were used to measure estrogen (Calbiotech ES180S-100), progesterone (IBL America ...
-
No products found
because this supplier's products are not listed.
Bruna Victorasso Jardim-Perassi, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... a Fc receptor blocker (Tonbo Biosciences 70-0161-M001 ...
-
No products found
because this supplier's products are not listed.
Qi Ding, et al.,
bioRxiv - Neuroscience 2019
Quote:
... PI3 kinase activity was measured using PI3 kinase activity ELISA kit from Echelon Biosciences according to the manufacture’s protocol ...
-
No products found
because this supplier's products are not listed.
Yonghui Ding, et al.,
bioRxiv - Bioengineering 2023
Quote:
... were expanded in human SMC growth medium kit (Cell Applications, Inc., 311K-500) under the standard culture condition (37 °C with 5% CO2 in a humid environment ...
-
No products found
because this supplier's products are not listed.
Cristina Aguirre-Portolés, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... five-micron sections of formalin-fixed paraffin-embedded tissue were stained using antibody against Androgen Receptor [(Leica AR-318-L-CE ...
-
No products found
because this supplier's products are not listed.
Rendy Hosea, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... Human genome DNA extracted from HCT116 cells using the TIANamp Genomic DNA Kit (Tiangen Biotech, Beijing, China) was used as template for amplifying the promoter regions ...
-
No products found
because this supplier's products are not listed.
Anthony A. Ruberto, et al.,
bioRxiv - Genomics 2021
Quote:
... primary human hepatocytes (BioIVT) were seeded 2-3 days prior to infection with 15,000-20,000 sporozoites per well ...
-
To help researchers in the global fight against the coronavirus, abm has developed an RT-qPCR...
Cat# G628,
100 Rxns/kit, please contact supplier for pricing.
Ask
Tamara Miljuš, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
For all experiments human embryonic kidney (HEK) 293SL cells84 were used and regularly tested for mycoplasma contamination (PCR Mycoplasma Detection kit, ABM, Canada). HEK293SL cells were maintained in Dulbecco’s Modified Eagle’s Medium (DMEM) ...
-
No products found
because this supplier's products are not listed.
Francisco J. Pardo-Palacios, et al.,
bioRxiv - Genomics 2023
Quote:
... in human and from 2.5 (cDNA-PacBio) to 1.38 (dRNA-ONT) ...
-
No products found
because this supplier's products are not listed.
Blagoje Soskic, et al.,
bioRxiv - Genetics 2019
Quote:
... we used ChIP grade antibodies specific to human H3K27ac histones (Diagenode). A negative control undergoing no IP (input ...
-
No products found
because this supplier's products are not listed.
Rebecca Garnham, et al.,
bioRxiv - Cancer Biology 2023
Quote:
Human ST3Gal1 sandwich pre-validated ELISA kits were purchased from Cambridge Bioscience (RayBioTech, ELH-ST3GAL1). Samples and standards were assayed in duplicate according to the manufacturer’s protocol.
-
No products found
because this supplier's products are not listed.
Madeleine F. Jennewein, et al.,
bioRxiv - Immunology 2021
Quote:
To investigate Fc receptor binding recombinant Fc receptors with an AviTag were biotinylated using a Bir500 kit (Avidity, Aurora, CO, USA) according to manufacturer’s instructions and purified using a Zeba Spin Desalting Column ...
-
No products found
because this supplier's products are not listed.
Yi Xiang See, Kaijing Chen, Melissa J. Fullwood,
bioRxiv - Genomics 2021
Quote:
... Beads were then washed thrice with Shearing Buffer D3 (Covaris), once with High Salt Washing Buffer (50mM HEPES pH 7.5 ...
-
No products found
because this supplier's products are not listed.
Miriana Battista, et al.,
bioRxiv - Microbiology 2023
Quote:
... The level of interleukin (IL)-6 and tumor necrosis factor (TNF)-α was also quantified by Human IL-6 and TNF-α ELISA Kits (ImmunoTools), respectively.
-
No products found
because this supplier's products are not listed.
Miriam R. Fein, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... Fc receptor blocker (Innovex Biosciences), and finally avidin/biotin blocking buffer (Vector Laboratories ...
-
No products found
because this supplier's products are not listed.
Erika Cecon, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... hCMEC/D3 cells were transduced with lentivirus containing hACE2 transcript (BPS Bioscience) at a MOI of 5 ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Seung-Eon Roh, et al.,
bioRxiv - Neuroscience 2023
Quote:
... CSF Orexin A was detected using a competitive ELISA Kit (Phoenix Pharmaceuticals) (Liguori et al ...
-
No products found
because this supplier's products are not listed.
Lukasz Chrobok, et al.,
bioRxiv - Neuroscience 2021
Quote:
... maxadilan (MAX; PAC1 receptor agonist; 100 nM; Bachem) and TCS-OX2-29 (TCS ...
-
No products found
because this supplier's products are not listed.
N.D. Maxwell, et al.,
bioRxiv - Neuroscience 2023
Quote:
... CA) using probes against the leptin receptor mRNA (Cat# 415951) and Opal 650 dye kit (Akoya Biosciences, Marlborough, MA) to label LepR mRNA ...
-
No products found
because this supplier's products are not listed.
Anthony D Fenton, et al.,
bioRxiv - Microbiology 2023
Quote:
... Lentiviruses for transduction of LTR-mCherry reporter and expression of HIV receptors (CD4, CXCR4, and CCR5) was generated by transfection of HEK293 cells using the Mirus TransIT transfection kit (Mirus). The resulting supernatant was cleared of debris by low-speed centrifugation (300g for 5 minutes ...
-
No products found
because this supplier's products are not listed.
Jennifer M. Zupancic, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Tissue staining was performed at room temperature using a Human-on-Human HRP-Polymer kit (Biocare Medical, BRR4056KG). Briefly ...
-
No products found
because this supplier's products are not listed.
Florian A. Lempp, et al.,
bioRxiv - Microbiology 2021
Quote:
... were transfected with plasmids encoding the following receptor candidates (all purchased from Genecopoeia): ACE2 (NM_021804) ...
-
Gliadin ELISA Kit
Cat# EGLD-100,
1.0 kit, 96 tests, USD $519.0
Ask
Yehezqel Elyahu, et al.,
bioRxiv - Immunology 2024
Quote:
... The levels of AST and ALT in murine serum were measured using EnzyChrom™ ELISA kits for AST and ALT (BioAssay Systems) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Aurelie Schwartzentruber, et al.,
bioRxiv - Neuroscience 2020
Quote:
... The ELISA was read on a PheraStar plate reader (BMG Labtech) as per the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Jan Steinkühler, et al.,
bioRxiv - Biophysics 2020
Quote:
... Human Transferrin – CF488A (Biotium) at 130 nM ...
-
No products found
because this supplier's products are not listed.
Michael J. Pereira, et al.,
bioRxiv - Microbiology 2021
Quote:
... Normal human serum (Complement Technologies) was diluted to 2.3% (v/v ...
-
No products found
because this supplier's products are not listed.
Xiaoxuan Zhuang, et al.,
bioRxiv - Immunology 2023
Quote:
... containing 10% human serum (Valley Biomedical) and were used within 4 days ...
-
No products found
because this supplier's products are not listed.
Rediet Zewdu, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... Animal Tissue RNA Purification Kit (Norgen Biotek) was used instead ...
-
No products found
because this supplier's products are not listed.
Tiago Gião, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... hCMEC/D3 (Tebu-Bio) is a well-characterized in vitro model of BBB ...
-
No products found
because this supplier's products are not listed.
Phyllis F Cheung, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Soluble PGRN levels in human plasma samples and culture supernatants were detected by a human PGRN ELISA kit (Adipogen Inc.). Please refer to the Supplementary Experimental Procedures for additional detail.
-
No products found
because this supplier's products are not listed.
Joseph E Kaserman, et al.,
bioRxiv - Cell Biology 2022
Quote:
Secreted total AAT was quantified from iHep supernatants using the human alpha-1-antitrypsin ELISA quantification kit (GenWay Biotech) per manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Lisa Pomeranz, et al.,
bioRxiv - Bioengineering 2023
Quote:
ELISA plates were coated with 1µg/mL human spleen ferritin (Lee Biosolutions, MO) in PBS overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Gustavo Monnerat, et al.,
bioRxiv - Pathology 2019
Quote:
... Brazil) and D3-testosterone (ISTD) from LGC Standards (London, England). Amino acid quantification was carried out using a TSQ Quantiva from Thermo Scientific (San Jose ...
-
No products found
because this supplier's products are not listed.
Kouhei Yoshida, et al.,
bioRxiv - Bioengineering 2023
Quote:
The AAV Titration ELISA Kit series (PROGEN Biotechnik GmbH) was used to quantify AAV capsid titers depending on the AAV serotype ...
-
No products found
because this supplier's products are not listed.
Qinqin Fei, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... human epithelial cell (HEC) media with the supplemental kit was purchased from Cell Biologics Inc ...
-
No products found
because this supplier's products are not listed.
Philipp Kolb, et al.,
bioRxiv - Microbiology 2020
Quote:
... human Fcγ-TexasRed (Rockland). Rituximab® (Rtx ...
-
No products found
because this supplier's products are not listed.
Rachael Kuintzle, et al.,
bioRxiv - Systems Biology 2023
Quote:
... All of the Notch receptor piggyBac constructs were derived from the vector PB-CMV-MCS-EF1-Puro (System Biosciences), with changes made to the promoter (CMV changed to PGK or CAG ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
CUT&RUN assay libraries for cultured cells or human kidneys were generated with the CUTANA kit (EpiCypher, 14-1048). For cultured cells ...
-
No products found
because this supplier's products are not listed.
Simona Selberg, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Recombinant human FTO protein was labeled with His-tag using Monolith His-Tag Labeling Kit RED-tris-NTA (NanoTemper Technologies GmbH; MO-L008). The labelled FTO protein (target ...
-
No products found
because this supplier's products are not listed.
Andrea R. Dos Santos, et al.,
bioRxiv - Microbiology 2022
Quote:
... Citric acid kit: Citric Acid Assay Kit (Megazyme, product Code: K-CITR). Phosphate kit ...