-
No products found
because this supplier's products are not listed.
Lindsay M. Leonard, et al.,
bioRxiv - Microbiology 2024
Quote:
... This diet was sterilized through double gamma irradiation at 10-20 kGy (Research Diets, New Brunswick, NJ). Food and water were provided ad libitum throughout the study ...
-
No products found
because this supplier's products are not listed.
Sherif Salah, et al.,
bioRxiv - Immunology 2022
Quote:
... and membrane protein peptide (by AMSBIO) were procured ...
-
No products found
because this supplier's products are not listed.
Ebrahim Elsangeedy, et al.,
bioRxiv - Physiology 2024
Quote:
... rabbit anti-peroxisome proliferator-activated receptor gamma (PPARγ; 1:1200 dilution; Biorbyt, LLC, Durham, NC, USA; Cat#: orb11291), rabbit anti-GPER (1:200 dilution ...
-
No products found
because this supplier's products are not listed.
Eric Waltari, et al.,
bioRxiv - Immunology 2019
Quote:
... Blocking solution (sciBLOCK Protein D1M solution, Scienion) was added at 200 μL/well with a multichannel pipet and allowed to incubate without agitation for 1 hour ...
-
No products found
because this supplier's products are not listed.
Takumi Kitamoto, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... In the Enteroendocrine induction model, we injected Gamma-secretase inhibitor (DBZ, 25 mpk dissolved in 0.5% Methocel / 0.1% Tween80) (Chiralix, Netherlands) at 10:00 for two consecutive days ...
-
No products found
because this supplier's products are not listed.
Ly Porosk, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Peptide-based transfection reagent Reagent007 from Icosagen suitable for suspension cells ...
-
No products found
because this supplier's products are not listed.
Anes Ju, et al.,
bioRxiv - Neuroscience 2023
Quote:
... followed by recording of oscillatory field potentials in gamma-range induced by 100 nM kainic acid (BN0281, BIOTREND Chemikalien GmbH) in ACSF for 30 min ...
-
No products found
because this supplier's products are not listed.
Tommaso Montecchi, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... SEB and SEE peptides (2μg/ml) (Toxin Technology) or 1% BSA for controls ...
-
No products found
because this supplier's products are not listed.
Rick G. Kim, et al.,
bioRxiv - Plant Biology 2024
Quote:
... Biotinylated peptides were searched using exogenous biotin (ExBio) on lysine as a variable modification ...
-
No products found
because this supplier's products are not listed.
Kuan-Yi Lu, et al.,
bioRxiv - Microbiology 2020
Quote:
All confocal images were exported as TIF files at the same brightness and contrast settings with no gamma correction using ZEN 2.3 software (Carl Zeiss, Germany). Exported images were analyzed by ImageJ/FIJI (82) ...
-
No products found
because this supplier's products are not listed.
Kamyab Javanmardi, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Membranes were blocked in LICOR Odyssey Blocking Buffer (Neta Scientific) incubated with the following primary antibodies overnight ...
-
No products found
because this supplier's products are not listed.
Gregory A. Breuer, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... Blocking was performed in TBS-T with 5% BSA (Gold Biotechnology) for 1h at room temperature ...
-
No products found
because this supplier's products are not listed.
Emily Tubbs, et al.,
bioRxiv - Bioengineering 2024
Quote:
... The cells were permeabilized by a blocking buffer containing FBS (ScienCell Research Laboratories ...
-
Atrial Natriuretic Peptide ( ANP ) ELISA / Assay Kit
Cat# K071-H1,
1.0 ea, USD $385.0
Ask
Soon Yew Tang, et al.,
bioRxiv - Pharmacology and Toxicology 2020
Quote:
Atrial natriuretic peptide (Arbor Assays, K026-H1, Ann Arbor, MI), total nitrate+nitrite (Cayman Chemical ...
-
No products found
because this supplier's products are not listed.
Breanna Q. Shen, et al.,
bioRxiv - Neuroscience 2022
Quote:
Slides were incubated with blocking buffer (10% Normal Goat Serum, Atlanta Biologicals, Cat #S13150h ...
-
No products found
because this supplier's products are not listed.
Samir M. Abdelmagid, et al.,
bioRxiv - Cell Biology 2020
Quote:
The MicroVue™ Helical Peptide EIA kit (Quidel, San Diego, CA) was used to measure the level of a helical peptide containing the residues 620-633 of the type I collagen α1 chain or more formally carboxy-terminal collagen crosslinks ...
-
No products found
because this supplier's products are not listed.
Belinda Liu, et al.,
bioRxiv - Biochemistry 2019
Quote:
... or the insulin receptor signal peptide were synthesized by Eton Biosciences. Similarly ...
-
No products found
because this supplier's products are not listed.
Francesco Caiazza, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... and peptides desalted with C18 Desalting Tips (Rainin, Oakland, CA, USA), lyophilized ...
-
No products found
because this supplier's products are not listed.
Joshua Johnson, et al.,
bioRxiv - Physiology 2020
Quote:
... Endogenous peroxidase blocking was performed by using 3% hydrogen peroxide (Labchem, Cat # LC154301). Sections were then washed in water ...
-
No products found
because this supplier's products are not listed.
Diogo F.T. Veiga, et al.,
bioRxiv - Genomics 2020
Quote:
... non-unique-PacBio+Uniprot (peptides mapped to both PacBio and Uniprot proteins), and multigene (peptides mapped to multiple genes).
-
The peptide is used to block Anti-Gamma-NaCH Antibody (#CPA7385) reactivity.
Cat# CBP7385,
1 mg USD $100.0, 5 mg USD $300.0
Ask
Rafał Zdrzałek, et al.,
bioRxiv - Plant Biology 2024
Quote:
... membranes were incubated with appropriate antibodies diluted in blocking buffer (α-FLAG: Cohesion Biosciences, at 1:3000 dilution ...
-
No products found
because this supplier's products are not listed.
Bijal A. Parikh, et al.,
bioRxiv - Immunology 2019
Quote:
... Fc receptor blocking was performed with 2.4G2 (anti-FcγRII/III) hybridoma (American Type Culture Collection) culture supernatants ...
-
No products found
because this supplier's products are not listed.
Emilio Boada-Romero, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Experiments using anti-PS blocking antibody were performed in µ-Slide Angiogeneis chambers (IBIDI, 81506) and cell numbers were scaled down accordingly.
-
No products found
because this supplier's products are not listed.
Mark J. Wall, et al.,
bioRxiv - Physiology 2020
Quote:
... Peptides for interfering with G protein signalling were obtained from Hello Bio (Bristol, UK) and were based on published sequences16 ...
-
No products found
because this supplier's products are not listed.
Logan S. Richards, et al.,
bioRxiv - Biochemistry 2021
Quote:
... The peptide crystals were harvested from hanging drops using CryoLoops™ from Hampton Research with no additional cryoprotectant other than the MPD already present and flash-frozen in liquid nitrogen ...
-
No products found
Matthias Felten, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Proteolysis into peptides was accomplished using 0.5% (w/w) Trypsin (sequencing grade; Worthington Biochemical) (37 °C ...
-
No products found
because this supplier's products are not listed.
Lydia Zhang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Peptides were diluted in water and acidified with 1.2M formic acid (Thomas Scientific, A11750) in preparation for mass spectrometry analysis.
-
No products found
because this supplier's products are not listed.
Anne-Sophie Hafner, et al.,
bioRxiv - Neuroscience 2019
Quote:
... After 30 min in blocking buffer cells were incubated with mouse anti-puromycin (Kerafast, 1:2000) for 1 h at room temperature ...
-
No products found
because this supplier's products are not listed.
Linda Balabanian, et al.,
bioRxiv - Biophysics 2021
Quote:
... Cells were then washed with Blocking Buffer: 2% (w/v) BSA (BioShop Canada Inc., Burlington, ON), 0.2% (w/v ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
Peter Verstraelen, et al.,
bioRxiv - Neuroscience 2022
Quote:
... Permeabilization was done in blocking buffer (0.1% bovine serum albumin, 10% normal horse serum (Innovative Research IGHSSER) in PBS ...
-
No products found
because this supplier's products are not listed.
Chiara Aloise, et al.,
bioRxiv - Microbiology 2023
Quote:
... The cells were then incubated in blocking buffer containing mouse anti-dsRNA (1:1000; English & Scientific Consulting), goat anti-eIF3η (1:200 ...
-
No products found
because this supplier's products are not listed.
Ji-Hoon Lee, et al.,
bioRxiv - Bioengineering 2024
Quote:
... incubated with primary antibody against spike protein diluted 1:5,000 in blocking buffer (Elabscience, E-AB-V1006) overnight in a 37°C incubator with 5% CO2 injection ...
-
No products found
because this supplier's products are not listed.
Krista K. Alexander, et al.,
bioRxiv - Biochemistry 2023
Quote:
Peptides were diluted in water and were analyzed using a 1.00 mm QS cuvette (Starna Cells). A JASCO J-710 circular dichroism spectrometer and JASCO Spectra Manager software were used to analyze the results using the following parameters ...
-
No products found
because this supplier's products are not listed.
The Nhu Nguyen, et al.,
bioRxiv - Microbiology 2023
Quote:
Antibody responses against IAV-S nucleoprotein (NP) were measured by using a commercial blocking ELISA (IDEXX, Montpellier, France), following the manufacturer’s recommendation ...
-
No products found
because this supplier's products are not listed.
Nikolas Nikolaou, et al.,
bioRxiv - Neuroscience 2020
Quote:
... This was removed and coverslips were incubated with fresh blocking solution containing anti-GFP 1:1000 (Torrey Pines Biolabs-TP401) and anti-SNRNP70 1:200 (Sigma-AV40276 ...
-
No products found
because this supplier's products are not listed.
Colton D. Payne, et al.,
bioRxiv - Biochemistry 2020
Quote:
... The resin used as an anchor for peptide assembly was Tentagel XV 4-hydroxymethyl phenoxyacetic acid (Rapp Polymere, GmbH). Prior to the loading of the C-terminal residue ...
-
No products found
because this supplier's products are not listed.
Jhansi L. Leslie, et al.,
bioRxiv - Microbiology 2019
Quote:
... each plate had a positive control consisting of toxin coated wells reacted with mouse TcdA monoclonal antibody TGC2 diluted 1:5,000 in blocking buffer (antibodies-online.com ABIN335169). The optical density at 410nm and 650nm was recorded on a VersaMax plate reader (Molecular Devices ...
-
No products found
because this supplier's products are not listed.
Marianne E Emmert, et al.,
bioRxiv - Developmental Biology 2022
Quote:
... through detection of the 7-amino-4-methylcoumarin (AMC) labeled fluorogenic peptide substrates Z-LLE-AMC (Boston Biochem #S-230) and LLVY-AMC (Chemicon #APT280) ...
-
No products found
because this supplier's products are not listed.
Takafumi Kato, et al.,
bioRxiv - Pathology 2021
Quote:
... PRR4 cDNA without a signal peptide sequence (corresponding to amino acids 17 to 134) was cloned into the pM-secSUMOstar Vector (7121, LifeSensors). SUMOstar-PRR4 vectors were transfected into Expi293 cells (1 mg of DNA per liter of transfection ...
-
No products found
because this supplier's products are not listed.
Marco Tognetti, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... the sample’s peptide concentrations were determined using a UV/VIS Spectrometer at 280 nm/430 nm (SPECTROstar Nano, BMG Labtech) and centrifuged at 14,000 × g at 4 °C for 30 min.
-
No products found
because this supplier's products are not listed.
Wenwei Li, et al.,
bioRxiv - Microbiology 2021
Quote:
... Crystal screening of Fab-peptide complexes were performed using the vapor-diffusion hanging drop method using the sparse matrix crystallization screens ProPlex (Molecular Dimensions), Index (Hampton Research) ...
-
No products found
because this supplier's products are not listed.
Michela Carlet, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... using a 5’ primer carrying NsiI and a 3’ primer carrying P2A-NsiI and ligated into the NsiI digested pCDH-SFFV-GLuc-T2A-mCherry vector downstream of the T2A peptide (Figure S2a) (pCDH-vector, System Bioscience). For inducible knockdown of target genes ...
-
No products found
because this supplier's products are not listed.
Zuriñe Antón, et al.,
bioRxiv - Cell Biology 2021
Quote:
... The DPC-bound peptide sample was prepared by dissolving lyophilized peptide in PBS supplemented with 7% D2O with 0.7% perdeuterated d38-DPC (Cambridge Isotope Laboratories) at a final concentration of ~ 2 mM ...
-
No products found
because this supplier's products are not listed.
Richard M. Hooy, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Peptide fractions were pooled then incubated at a molar ratio of 1:1.1 (excess lipid) with MPB-PE (Avanti Polar Lipids) for 3- 12 hours at 25C with end-over-end mixing ...
-
No products found
because this supplier's products are not listed.
Toshiharu Ichinose, et al.,
bioRxiv - Neuroscience 2024
Quote:
... The ribosome-bound mRNA was eluted with 50 µl of 100 µg/ml 3× FLAG peptide (GEN-3XFLAG- 25, Protein Ark) dissolved in the lysis buffer.
-
No products found
because this supplier's products are not listed.
Jesse Goyette, et al.,
bioRxiv - Immunology 2020
Quote:
... For the avitag-CD3ζ ITAM3 peptide DNA construct BirA-transformed BL21 (DE3) Escherichia coli (BPS Bioscience) were used ...
-
No products found
because this supplier's products are not listed.
Gema M. Olivarria, et al.,
bioRxiv - Microbiology 2021
Quote:
... Cells were incubated overnight at 4°C in blocking solution with primary antibodies anti-MAP2 (EnCor Biotech. Cat:NC0388389) and anti-SARS-CoV-2 nucleocapsid (Sino Bio ...
-
No products found
because this supplier's products are not listed.
Zahra Hosseinzadeh, et al.,
bioRxiv - Bioengineering 2023
Quote:
... The insulin of each sample was measured with the C-Peptide & Insulin AccuBind VAST ELISA Kits (Monobind Inc., USA). Three independent experiments were performed for each group ...
-
No products found
because this supplier's products are not listed.
Erin M. Euliano, et al.,
bioRxiv - Bioengineering 2024
Quote:
... Near-infrared fluorescent peptides were made by coupling 2 equivalents N-hydroxysuccinimide (NHS) ester-functionalized ATTO 647N (ATTO-TEC, Siegen, Germany) to the N-terminus with 4 equivalents of DIEA overnight protected from light ...