-
No products found
because this supplier's products are not listed.
Joanna M. Cooper, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Alpha-2-macroglobulin was purchased from Athens Research and was activated by methylamine as described (Ashcom et al. ...
-
No products found
because this supplier's products are not listed.
Hsiao-Yun Chen, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... then embedded/inserted into paraffin recipient block/negative mold (IHC World; 10*17 Quick Ray mold IW-UM01-1). Empty slots were filled with blank paraffin cores ...
-
No products found
because this supplier's products are not listed.
Ling Zhou, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
Each confocal dish was first filled with 1 mL of 5 g/mL collagen (Helena Laboratories, TX, USA) and left at 4 °C overnight ...
-
No products found
because this supplier's products are not listed.
Kamyab Javanmardi, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Membranes were blocked in LICOR Odyssey Blocking Buffer (Neta Scientific) incubated with the following primary antibodies overnight ...
-
No products found
because this supplier's products are not listed.
Marc Sunden, et al.,
bioRxiv - Biochemistry 2023
Quote:
A peptide (NH2-KKKYPGGSTPVSSANMM-COOH) containing an O-GlcNAcylation site of human Casein kinase II subunit alpha (underlined sequence) was custom synthesized by Nordic BioSite. A mixture of 6 mM glutaraldehyde ...
-
No products found
because this supplier's products are not listed.
Yun Jin Chae, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Tissue samples were incubated for 3 h at RT with the primary antibody (anti-CD8 alpha) before visualization with the Polink-2 HRP Plus Broad DAB Detection System for Immunohistochemistry kit (GBI Labs, Bothell, WA) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Qingxia Zhao, et al.,
bioRxiv - Immunology 2021
Quote:
... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
No products found
because this supplier's products are not listed.
The Nhu Nguyen, et al.,
bioRxiv - Microbiology 2023
Quote:
Antibody responses against IAV-S nucleoprotein (NP) were measured by using a commercial blocking ELISA (IDEXX, Montpellier, France), following the manufacturer’s recommendation ...
-
No products found
because this supplier's products are not listed.
Colton D. Payne, et al.,
bioRxiv - Biochemistry 2020
Quote:
... The resin used as an anchor for peptide assembly was Tentagel XV 4-hydroxymethyl phenoxyacetic acid (Rapp Polymere, GmbH). Prior to the loading of the C-terminal residue ...
-
No products found
because this supplier's products are not listed.
Vera Vysochinskaya, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... or to 5 µL peptide/liposome complexes with siRNA and applied to a freshly cleaved mica (SPI Supplies, West Chester, PA, USA). The mixture was then incubated at room temperature for 1 minute ...
-
No products found
because this supplier's products are not listed.
Maxwell P. Bui-Marinos, et al.,
bioRxiv - Immunology 2021
Quote:
... and RNA quality was examined by electrophoresing 1 μg of RNA on a 1% agarose gel containing 1% bleach (Aranda et al., 2012) and 1 × RedSafe nucleic acid staining solution (FroggaBio) in 1 × TAE buffer at 100 V for 35 min ...
-
No products found
because this supplier's products are not listed.
Wenzhi Feng, et al.,
bioRxiv - Cell Biology 2021
Quote:
... polyclonal anti-Hexokinase 1 rabbit IgG (United States Biological, 169073, 1:10000), polyclonal anti-NDT80 rabbit IgG (1:10000) ...
-
No products found
because this supplier's products are not listed.
Geoffrey L. Rogers, et al.,
bioRxiv - Immunology 2023
Quote:
... 1 µg of His-tagged HIV-1 JR-CSF gp120 (Immune Technology) was added to cells for 15 min at room temperature ...
-
No products found
because this supplier's products are not listed.
Giorgio Anselmi, et al.,
bioRxiv - Immunology 2019
Quote:
... 1% BSA (Apollo Scientific) and 2 mM EDTA (Life Technologies) ...
-
magnetofection
difficult to transfect cells
Cat# KC30296,
PolyMag 100µL+PolyMag Neo100µL+ CombiMag 100µL+Magnetic Plate MF96000, USD $640.63/KIT
Ask
Andrew S. Flies, et al.,
bioRxiv - Immunology 2020
Quote:
... Digested proteins in PBS were diluted 1:1 in Squalvax (Oz Biosciences # SQ0010) to a final concentration of 0.1 μg/μL and was mixed using interlocked syringes to form an emulsion ...
-
Recombinant Antigen
Cat# REC31719-100,
100µg USD $503.0
Ask
Emanuele Andreano, et al.,
bioRxiv - Immunology 2020
Quote:
... were coated with 25 μl/well of antigen (1:1 mix of S1 and S2 subunits, 1 μg/ml each; The Native Antigen Company, Oxford, United Kingdom) diluted in coating buffer (0.05 M carbonate-bicarbonate solution ...
-
No products found
because this supplier's products are not listed.
Daniel Chen, et al.,
bioRxiv - Neuroscience 2024
Quote:
Motor neurons were dissociated using a 1:1 dissociation solution of Accutase and Accumax (Innovative Cell Technologies Inc.) were counted using Trypan Blue to ensure a survival rate above 80% ...
-
No products found
because this supplier's products are not listed.
Celine Everaert, et al.,
bioRxiv - Molecular Biology 2019
Quote:
... and 1 µl reaction buffer (ArcticZymes 66001). Of the resulting volume ...
-
No products found
because this supplier's products are not listed.
Serena R.G. Page, et al.,
bioRxiv - Plant Biology 2020
Quote:
... 1 mL/L of B5 vitamins (Phytotechnology Laboratories), and 0.5 μM TDZ (Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Philip Kawalec, et al.,
bioRxiv - Physiology 2022
Quote:
... Serum Troponin-I was measured using the Ultra-Sensitive Mouse Cardiac Troponin-I ELISA Kit purchased from Life Diagnostics (CTNI-1-US; Life Diagnostics; West Chester, PA).
-
No products found
because this supplier's products are not listed.
Jessica B. Sarthi, et al.,
bioRxiv - Physiology 2023
Quote:
... Mice were anesthetized with oxygen-delivered isoflurane (1-3%) at 1 L/min via a vaporizer (Braintree Scientific, Inc, Braintree, Mass). Mouse temperature was monitored by rectal probe and maintained at 37°C through automated warming using a controlled warming pad (ATCC 2000 ...
-
No products found
because this supplier's products are not listed.
Travis C. Glenn, et al.,
bioRxiv - Genomics 2019
Quote:
... Protocol 1: EZNA Tissue DNA KIT (Omega Bio-Tek, USA); Protocol 2 ...
-
No products found
because this supplier's products are not listed.
Hiroshi Yamaguchi, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Methylated gold nanoparticles (final 1:2 dilution; CGM2K-15-25, Cytodiagnostics) were added as fiducial markers ...
-
No products found
because this supplier's products are not listed.
Edward G. Meloni, et al.,
bioRxiv - Neuroscience 2023
Quote:
... with laboratory bedding (Alpha Chip; Northeastern Products Co.) and one square (5 x 5 cm) of nesting material (Nestlet; Ancare). All mice were maintained on 12/12 h light dark cycles (lights on at 700 h ...
-
No products found
because this supplier's products are not listed.
Ottavia Romoli, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... The bloodmeal was provided to mosquitoes in an autoclaved Hemotek reservoir (Hemotek) replacing the collagen membrane with a Parafilm sheet (Bemis) sterilised by a 10 min H2O2 treatment ...
-
No products found
because this supplier's products are not listed.
Ina J. Andresen, et al.,
bioRxiv - Cell Biology 2020
Quote:
... RNA from 3 batches (batch 17, 19 and 25) was isolated using the “Single Cell RNA Purification Kit” (NORGEN BIOTEK CORP, Canada) with an 8 ul elution buffer ...
-
No products found
because this supplier's products are not listed.
Elodie Darbo, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... FISH assay was performed using a commercially available MYOCD FISH probe labeled in spectrum orange and a chromosome 17 control probe labeled in FITC (EG-MYOCD-CHR17-20ORGR, Empire Genomics, Williamsville, NY, USA). MYOCD and control probe enumeration was performed with a Nikon Eclipse 90i fluorescent microscope with appropriate filters ...
-
No products found
because this supplier's products are not listed.
Wei Zhang, et al.,
bioRxiv - Cell Biology 2023
Quote:
... freshly made thick layers of pure collagen fibres described above were incubated in 100 µL of 50 µg/ml multimeric vitronectin (Molecular Innovations Inc, HVN-U) in 20 mM sodium phosphate buffer for 1 h at RT ...
-
No products found
because this supplier's products are not listed.
Teodor E. Yordanov, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Sodium Hyaluronate (1-1.8MDa) (Lifecore Biomedical; HA15M-1), Hyaluronidase from Streptomyces hyalurolyticus (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Sophie E. Cousineau, et al.,
bioRxiv - Microbiology 2022
Quote:
... mouse anti-JFH-1 NS5A (clone 7B5, BioFront Technologies, 1:10,000). Blots were incubated for 1 hour with HRP-conjugated secondary antibodies diluted in 5% skim milk ...
-
No products found
because this supplier's products are not listed.
Timo Baade, et al.,
bioRxiv - Cell Biology 2023
Quote:
... 6 (mouse monoclonal, D14HD11, Aldevron; WB 1:6000, IF 1:200); mouse monoclonal anti 6xHis (mouse monoclonal ...
-
No products found
because this supplier's products are not listed.
Juliana Bragazzi Cunha, et al.,
bioRxiv - Pathology 2021
Quote:
... 1 mM Copro-I (coproporphyrin-I dihydrochloride, Frontier Scientific, Catalog#:C654-1), vehicle or 0.2% calcein for 30min in the dark and vortexed every five minutes ...
-
No products found
because this supplier's products are not listed.
Rudolf O. Schlechter, et al.,
bioRxiv - Microbiology 2023
Quote:
... gas permeability of 0.6 m3 m−2 day−1 and water loss of 1 g m−2 day−1; Brooks Life Sciences, UK), and incubated at 30°C with shaking ...
-
No products found
because this supplier's products are not listed.
Saaz Sakrikar, Amy Schmid,
bioRxiv - Genomics 2021
Quote:
... 1 µg/mL mevinolin (AG Scientific) was added to liquid medium and 2.5 µg/mL to solid media to maintain selective pressure on the plasmid.
-
No products found
because this supplier's products are not listed.
Andrew J. Stout, et al.,
bioRxiv - Bioengineering 2021
Quote:
... 10ng/mL insulin-like growth factor 1 (IGF-1; Shenandoah Biotechnology #100-34AF-100UG, Warminster, PA, USA) and 10 ng/mL epidermal growth factor (EGF ...
-
No products found
because this supplier's products are not listed.
Qi Qu, et al.,
bioRxiv - Physiology 2023
Quote:
... followed by covering with a drop of mineral oil (1:1 - Halocarbon oil 700:Halocarbon oil 27). Some 2 nl of 500 ng/μl gRNAs targeting the exon 3 of ktub (5’-CGCATTACGCGGGACAGGAA-3’ and 5’-CGGAGATCTCATCGCACGAGT-3’ ...
-
No products found
because this supplier's products are not listed.
Linglei Jiang, et al.,
bioRxiv - Immunology 2022
Quote:
... IgA (1:250, Brookwood Biomedical, AL, USA) or IgM (1:250 ...
-
No products found
because this supplier's products are not listed.
Antje Neeb, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... panBAG-1 (human, rabbit monoclonal, RM356, RevMAb), panBAG-1 (mouse ...
-
No products found
because this supplier's products are not listed.
P Whyte-Fagundes, et al.,
bioRxiv - Neuroscience 2023
Quote:
... AA43279 (Focus biomolecules, CAS: 354812-16-1), Chlorzoxazone (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Wan-ting He, et al.,
bioRxiv - Immunology 2022
Quote:
... WIV1 (residues 1-1238, GenBank: KF367457) and SHC014 (residue 1-1238, GenBank: AGZ48806.1) were constructed into the phCMV3 vector (Genlantis, USA) using the Gibson assembly (NEB ...
-
No products found
because this supplier's products are not listed.
Caitlin P. Mencio, et al.,
bioRxiv - Cell Biology 2022
Quote:
... 1 mU heparinase III (Seikagaku Corp., Tokyo, Japan), 31.3 mM sodium acetate ...
-
No products found
because this supplier's products are not listed.
Chetan Kumar Arya, et al.,
bioRxiv - Biochemistry 2020
Quote:
... and Wizard Classic 1 and 2 (Rigaku Japan). Crystals of DMFase were obtained by mixing 200 nl of protein in buffer A with equal volumes of precipitant ...
-
No products found
because this supplier's products are not listed.
Sepiedeh Keshavarzi, et al.,
bioRxiv - Neuroscience 2021
Quote:
... submerged in 1 % Tergazyme (in distilled water, Alconox) for at least an hour ...
-
No products found
because this supplier's products are not listed.
Jinqiang Zhang, et al.,
bioRxiv - Neuroscience 2020
Quote:
... A Micro-1 microsyringe pump controller (RWD life science) was used to inject viral vectors ...
-
No products found
because this supplier's products are not listed.
Corinna Probst, et al.,
bioRxiv - Microbiology 2022
Quote:
... Pieces of upper and lower leaf sides were mounted onto metal stubs with double-sided sticky tape and coated with gold: palladium (1:1) in a Polaron SC 7640 (Quorum Technologies, Newhaven, UK) automated sputter coater ...
-
No products found
because this supplier's products are not listed.
Catherine Hume, et al.,
bioRxiv - Animal Behavior and Cognition 2022
Quote:
... 11-OH-THC and THC-COOH (at a known concentration of 10 ng/ml in 1:1 methanol and water; Cerilliant, Round Rock, TX, USA). Then samples were sonicated for 20-minutes to precipitate proteins ...
-
No products found
because this supplier's products are not listed.
Jenny Vo, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... The cells are lysed in a 2ml Eppendorf tube containing 1mL 0.5mm zirconia beads by vortexing for six cycles of 1 minute vortexing with 1 minute pauses using the Turbomix attachment on a Vortex Genie 2 (Scientific Industries Inc SKU: SI-0564) that had been pre-run at max speed for 1 minute preceding the vortexing to ensure consistent machine performance in the cold ...
-
No products found
because this supplier's products are not listed.
Olivia M. S. Carmo, et al.,
bioRxiv - Biochemistry 2021
Quote:
... rabbit α0801 (1:1000, gift from T. de Koning Ward and P. Gilson [9]), rabbit αMESA (1:1000 ...
-
No products found
because this supplier's products are not listed.
Taka A. Tsunoyama, et al.,
bioRxiv - Cell Biology 2021
Quote:
... with a constant voltage of 100 V for 1 h (Mini Protean Tetra Cell). The immuno-detection was performed by a SNAP i.d ...
-
No products found
because this supplier's products are not listed.
Christian M. Smolko, Kevin A. Janes,
bioRxiv - Molecular Biology 2019
Quote:
... and the plate incubated for 1 hr at 37°C on a Jitterbug mixer (Boekel Scientific #130000) with mix setting set to 1 ...