-
No products found
because this supplier's products are not listed.
Kevin M. Knox, et al.,
bioRxiv - Neuroscience 2021
Quote:
... FluoroJade-C (FJ-C; catalog #1FJC) was from Histo-Chem Inc (Jefferson ...
-
No products found
because this supplier's products are not listed.
Nadezda A. Fursova, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Antibody-bound nucleosomes were captured for 1 hr at 4°C using protein A agarose (Repligen) beads ...
-
No products found
because this supplier's products are not listed.
Benjamin J. Reisman, et al.,
bioRxiv - Biochemistry 2021
Quote:
... 1.6 mM BTTAA ligand (Click Chemistry Tools), and 5 mM sodium ascorbate ...
-
No products found
because this supplier's products are not listed.
Luisa de Lemos, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Fluoro-Jade C labelling was performed on retinal organoids cryosections using the Fluoro-Jade® C staining kit (Biosensis) and following the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Samuel R. Witus, et al.,
bioRxiv - Biochemistry 2023
Quote:
... cells were shifted from 37 °C to 16 °C and supplemented with 1 mM Bpa (dissolved in 1M NaOH; Bachem) and 100 µM ZnCl2 ...
-
No products found
because this supplier's products are not listed.
Kartikeya Vijayasimha, et al.,
bioRxiv - Immunology 2022
Quote:
... Transfected cells were allowed to recover for two days and were then labelled at 4°C with anti-Thy1.1 antibody (clone HIS51, eBiosciences) for 30 minutes in PBS buffer containing 0.1% BSA (Amresco). Cells were then washed in buffer and incubated with anti-mouse IgG microbeads beads (Miltenyi Biotech ...
-
No products found
because this supplier's products are not listed.
Erin A. Nekritz, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... we co-transfected the cells with 50 ng of pMIR-REPORT constructs containing the 3’UTR sequences together with 50 ng of a Renilla housekeeping control plasmid and 100 nM of miR-424 or miR-503 mimics or a miRNA negative control (Dharmacon #C-300717-05, #C-300841-05, or #CN-001000-01-05, respectively) using the TransIT-X2 reagent (Mirus 6003). 24 hours after transfection ...
-
No products found
because this supplier's products are not listed.
Amaris J Cardenas, et al.,
bioRxiv - Microbiology 2024
Quote:
... using reaction reagents: 2.5mM THPTA (tris-hydroxypropyltriazolylmethylamine) ligand (Lumiprobe), 0.06mM FAM alkyne 5-isomer (5-Carboxyfluorescein ...
-
No products found
because this supplier's products are not listed.
Thibault Legal, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Cheeseman, 1: 1000), guinea pig CENP-C (pAb, MBL PD030, 1:2000) and human ACA antibodies (Cambridge Biosciences, 1:100). Hoechst 33342 (ThermoFisher Scientific ...
-
No products found
because this supplier's products are not listed.
Christine Chevalier, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Immunostaining was performed overnight at +4°C with primary antibodies (H3K4me2 1:1000; Abcam ab32356) (H3K4me3 1:200; Diagenode C15410003) (H3K4me2 1:1000; EpiGentek A4032) (LAMP1 1:1000 ...
-
No products found
because this supplier's products are not listed.
Florent Ailloud, et al.,
bioRxiv - Microbiology 2023
Quote:
... Among the motifs not validated by PacBio data ...
-
No products found
because this supplier's products are not listed.
Tsai-Ning Li, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 5 μM BODIPY-TMR Phosphatidylinositol 4,5-bisphosphate (C-45M16A, Echelon Bioscience), furimazine (Promega ...
-
No products found
because this supplier's products are not listed.
Rebecca O’Cleirigh, Roslyn Gibbs,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... and incubated at 37°C and 5% CO2 (Nuaire, DH Autoflow). Media was changed every 48 hours and cells passaged when they reached confluence as recommended by the supplier ...
-
No products found
because this supplier's products are not listed.
Priyanka Chatterjee, et al.,
bioRxiv - Microbiology 2024
Quote:
... Escherichia coli strains were grown at 37°C in NZCYM (RPI) medium supplemented with ampicillin (100 µg mL-1 final ...
-
No products found
because this supplier's products are not listed.
Mathew Miller, et al.,
bioRxiv - Molecular Biology 2022
Quote:
MULTI-ARRAY Standard 96-well plates (Meso Scale Diagnostics, Rockville, Maryland) were coated overnight at 4°C with K1 anti-dsRNA mouse monoclonal antibody (SCICONS, Budapest, Hungary). Plates were blocked using 5% MSD Blocker A (Meso Scale ...
-
No products found
because this supplier's products are not listed.
Julia Fath, et al.,
bioRxiv - Cell Biology 2022
Quote:
... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
No products found
because this supplier's products are not listed.
Mastura Akter, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Stainless steel guide cannulae (Double/O.D.0.41mm-27G/C, cat # 62069, RWD life science.com.ltd.) were bilaterally positioned into ACC region (2.4 mm anterior to bregma and 0.5 mm lateral from midline ...
-
No products found
because this supplier's products are not listed.
Xiaoxuan Lin, et al.,
bioRxiv - Biophysics 2023
Quote:
... and hand-packing into a column (2 mm ID × 2 cm, IDEX C-130B). After digestion ...
-
No products found
because this supplier's products are not listed.
Shan Jiang, et al.,
bioRxiv - Synthetic Biology 2023
Quote:
... The protein standard with the C-terminal FLAG tag (E-PKSH032870.10) was from Biomol. Linear DNA templates were produced by PCR and were PCR purified ...
-
No products found
because this supplier's products are not listed.
Kelly Snead, et al.,
bioRxiv - Biochemistry 2022
Quote:
... at 4°C using 40µL bed volume (BV) nickel-charged IMAC tips (Biotage, Uppsala, Sweden). The columns were washed in a 96-well deepwell plate with 20BV dH2O and then equilibrated in 20BV of 20mM HEPES pH 7.4 ...
-
No products found
because this supplier's products are not listed.
Zane Mitrevica, Andrew J Murray,
bioRxiv - Neuroscience 2023
Quote:
... at a speed of 23 nL/s with a Nanoject II injector (Drummond scientific) coupled to a stereotaxic frame (Kopf model 902) ...
-
No products found
because this supplier's products are not listed.
Diego Y. Grinman, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... Five percent sucrose water or placebo pellets (15mg/pellet; Cat# C-111, Innovative Research of America) were used as controls ...
-
No products found
Jennifer B. Silverman, et al.,
bioRxiv - Cell Biology 2024
Quote:
... Cells were replated onto 35mm glass-bottom dishes or coverslips (Cellvis #D35-20-1.5-23 N) and incubated in Lipfectamine overnight ...
-
No products found
because this supplier's products are not listed.
Anna E Mammel, et al.,
bioRxiv - Cell Biology 2021
Quote:
... PNA probes were diluted to 50 μM in 85°C hybridization buffer (60% formamide + 20 mM Tris, pH 7.4 + 0.1 μg/mL salmon sperm DNA (Trevigen)) and coverslips were simultaneously washed at 85°C in 2x SSC ...
-
No products found
because this supplier's products are not listed.
Chongping Li, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... and goat anti-mouse IgG secondary antibody (L3032, Signalway Antibody).
-
Make your own fluorescent antibody in one easy step.
Quick and easy - one-step labeling in 30...
Cat# K-11055-010,
1 kit, USD $360.00/ea
Ask
Katharina Hutter, et al.,
bioRxiv - Immunology 2022
Quote:
... Bound antibodies were visualized with HRP-labeled secondary antibodies and the ECL system (Advansta) on a light-sensitive film (Amersham ...
-
No products found
because this supplier's products are not listed.
Ignasi Casanellas, et al.,
bioRxiv - Bioengineering 2021
Quote:
... immunostained with anti-C×43 antibody and Sir-Actin (Tebu-bio, SC001), and imaged with a Zeiss LSM780 Confocal Microscope (Zeiss Microscopy ...
-
No products found
because this supplier's products are not listed.
Arun Upadhyay, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Arg-C (Biovendor, Cat#RBG40003005), trypsin (Promega ...
-
No products found
because this supplier's products are not listed.
Elisangela Bressan, et al.,
bioRxiv - Genomics 2023
Quote:
... Primary antibodies were applied overnight at 4°C and included TH (Pel-Freez Biologicals #P40101 and Merck Millipore #AB9702 ...
-
No products found
because this supplier's products are not listed.
Guizhen Fan, et al.,
bioRxiv - Biophysics 2022
Quote:
... Membranes were probed with a rabbit polyclonal antibody against the C-terminal 19aa of IP3R1 (CT1; #ARC154, Antibody Research Corporation) at a 1:1000 dilution ...
-
No products found
because this supplier's products are not listed.
Irina Sbornova, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Whole eye blots were probed overnight at 4 °C with 1 of two PDE11A antibodies: the pan-PDE11A antibody PD11-112 (1:1000, rabbit, Fabgennix) or the PDE11A4-specific antibody PDE11A#1-8113A (1:10,000 ...
-
No products found
because this supplier's products are not listed.
Hitika Gulabani, et al.,
bioRxiv - Plant Biology 2021
Quote:
... rinsed and incubated overnight at 4°C with indicated primary antibodies [anti-SNC1 (Abiocode; R3588-1), anti-PR1 ...
-
No products found
because this supplier's products are not listed.
Natalia Gebara, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... and 2% Chang Medium C (Irvine Scientific), 20% Fetal Calf Serum (Invitrogen ...
-
No products found
because this supplier's products are not listed.
Emily K. Sims, et al.,
bioRxiv - Pathology 2019
Quote:
... Three of the donors with type 1 diabetes had detectable random serum C-peptide and 13 were classified by nPOD as C-peptide negative (random serum C-peptide <0.017nmol/L via TOSOH immunossay) (12) ...
-
No products found
because this supplier's products are not listed.
Takumi Chinen, et al.,
bioRxiv - Cell Biology 2020
Quote:
... proTAME (APC/C inhibitor, I-440, Boston Biochem), Cytochalasin B (actin inhibitor ...
-
No products found
because this supplier's products are not listed.
Andrew LaPoint, et al.,
bioRxiv - Physiology 2023
Quote:
... and cholesterol (2%) (HFHF-C, Research Diets, D09100310) diet or a matched sucrose ...
-
No products found
because this supplier's products are not listed.
Sourav Roy, et al.,
bioRxiv - Microbiology 2023
Quote:
... ELISAs specific for the lectin pathway contained single 1 μM concentrations of FbpC-C or BBK32-C incubated with 2% C1q-depleted NHS (Complement Technologies). Serum incubations were performed in complement ELISA buffer (10 mM HEPES pH 7.3 ...
-
No products found
because this supplier's products are not listed.
Danielle L. Michell, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... and incubated overnight with rocking at 4°C with anti-human apoA-I primary antibody (mouse monoclonal, 1:8000, Meridian Life Sciences). Membranes were washed 3X for 10min with 1X TBS-T (0.1% Tween 20 ...
-
No products found
because this supplier's products are not listed.
Yosif Zaki, et al.,
bioRxiv - Neuroscience 2021
Quote:
... Layers of adhesive cement (C&B Metabond) followed by dental cement (A-M Systems) were spread over the surgical site ...
-
No products found
because this supplier's products are not listed.
Voddu Suresh, et al.,
bioRxiv - Microbiology 2021
Quote:
... Digestion was carried out at 37°C for 16 hours using trypsin (Sciex, #4326682) at a final concentration of 1:20 (w/w) ...
-
No products found
because this supplier's products are not listed.
Sylvie Deborde, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... Experiments were performed at 37°C with a MFP-3D-BIO AFM microscope (Oxford Instruments). Fluorescent images of GFP-expressing HEI-286 SCs and RFP-expressing MiaPaCa-2 cancer cells were acquired together with the stiffness maps ...
-
No products found
because this supplier's products are not listed.
Amanda M. Travis, et al.,
bioRxiv - Cell Biology 2022
Quote:
... and C-terminal MYC tag was placed in front of human NPHP3 (GeneCopoeia GC-H2370). All mutations to replace the lipidated cysteine with alanine were made using PCR mutagenesis (Weiner et al. ...
-
No products found
because this supplier's products are not listed.
Sami T. Tuomivaara, et al.,
bioRxiv - Biochemistry 2023
Quote:
... supplemented with 2% in-house heat-treated (56 °C for 30 min) FBS (Atlanta Biologicals) and GlutaMAX (for proteomics) ...
-
No products found
because this supplier's products are not listed.
Yuxin Lin, et al.,
bioRxiv - Biophysics 2024
Quote:
... The sample was then positioned onto a heated stage (37 °C. Heating elements: Bioscience Tools, TC-E35 ...
-
No products found
because this supplier's products are not listed.
Toshiyuki Oda, et al.,
bioRxiv - Immunology 2022
Quote:
... and 4 µl of HMC buffer containing cytochrome c-stabilized 15-nm colloidal gold (BBI Solutions) was applied for attachment of fiducial markers (Oda et al. ...
-
No products found
because this supplier's products are not listed.
Magdalena Miranda, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Temperature was controlled with a servo-controlled heating pad (37°C ± 0.5; Fine Science Tools, Vancouver, Canada). Craniotomies for tetrode implantation were drilled in the skull above the CA3 (AP ...
-
No products found
because this supplier's products are not listed.
Abigail E. Powell, et al.,
bioRxiv - Immunology 2020
Quote:
... plates were washed 3X with PBST and blocked overnight at 4 °C with ChonBlock Blocking/Dilution ELISA Buffer (Chondrex). ChonBlock was removed manually and plates were washed 3X with PBST ...
-
No products found
because this supplier's products are not listed.
A Elgheznawy, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Platelets were activated with appropriately diluted agonists for 8 min at 37°C followed by 8 min at RT in the presence of saturating amounts of PE-coupled JON/A (4H5, Emfret Analytics) detecting activated αIIbβ3 integrin and FITC-coupled anti-P-selectin (Wug.E9 ...
-
No products found
because this supplier's products are not listed.
Zainul S. Hasanali, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... 100μL of cell suspension was removed to a 1.2mL eppendorf tube and placed at -20°C for subsequent pathogen testing (IDEXX -hIMPACT panel). Remaining cells were spun down and supernatant removed ...
-
No products found
because this supplier's products are not listed.
Marissa Lindman, et al.,
bioRxiv - Immunology 2023
Quote:
... IFNAR-1 monoclonal antibody (MAR1-5A3, Leinco Technologies) or isotype control (GIR-208 ...