Labshake search
Citations for GenScript :
1 - 20 of 20 citations for cis Clopidogrel MP 13C d3 Derivative Pair of Enantiomers since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2024Quote: ... The D-enantiomers of all peptides were purchased from GenScript and used without further modification.
-
bioRxiv - Biochemistry 2024Quote: ... The pNT015 derivatives were prepared by Gene Synthesis and Mutagenesis (SC1441, GenScript) or site-directed mutagenesis.
-
bioRxiv - Synthetic Biology 2020Quote: ... pSensor09 was constructed by amplifying the backbone plasmid p416TEF1 using primer pair pYDA05/20 and primer pair pYDA21/22 to amplify PTEF1-YAS3-TCYC1 (Genscript_003).
-
bioRxiv - Immunology 2021Quote: Selected pairs of heavy and light chain sequences were synthesized by GenScript and sequentially cloned into IgG1 and Igκ/λ expression vectors ...
-
bioRxiv - Immunology 2024Quote: Selected pairs of heavy and light chain sequences were synthesized by GenScript and sequentially cloned into IgG1 ...
-
bioRxiv - Immunology 2024Quote: Selected pairs of heavy and light chain sequences were synthesized by GenScript and sequentially cloned into IgG1 ...
-
bioRxiv - Biochemistry 2021Quote: Synthetic Crotamine derivative peptides (CDP) in the L- and D-enantiomeric conformations were synthesised by Genscript (Leiden, NL), with a purity of > 95% (Supplementary Fig ...
-
bioRxiv - Molecular Biology 2024Quote: ... competent cells were transformed with 50 ng of pGEX-4T-1-GST-TEV.TZF-WT or the TZF-NLSmut derivative which were synthesized by Genscript. The constructs contained TTP TZF domain (amino acids 93-165 ...
-
bioRxiv - Microbiology 2021Quote: ... The FRET-pair substrate Abz-LPETG-Dap(Dnp)-OH (Genscript, Piscataway, NJ, Unites States) and the tetraglycine (Sigma Aldrich ...
-
bioRxiv - Bioengineering 2022Quote: ... and gene expression was examined by real-time PCR using primer pairs (Genscript, Nanjing, China) and SYBR Green (Invitrogen ...
-
bioRxiv - Biochemistry 2023Quote: The transcription template for the BoxB tethered assay is a derivative of our previously described template and was purchased from GenScript (35). The 5′ UTR was replaced with one of two 5′ UTR sequences possessing varying degrees of secondary structure:
-
bioRxiv - Microbiology 2024Quote: Synthetic plasmids (pUC57 derivative) expressing the mature parts of bacteriocins under the control of the T7 promoter were provided by GenScript (Piscataway, NJ). These plasmids (Table S6 ...
-
bioRxiv - Molecular Biology 2023Quote: ... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
bioRxiv - Immunology 2022Quote: ... the following pairs of primary antibodies were used: 1) TCRα-TCRβ crosslinking: rabbit anti-c-Myc (Genscript) and mouse anti-V5 (Genscript) ...
-
bioRxiv - Immunology 2022Quote: ... This recombinant SmCI-1 was used to generate a rabbit anti-Sm-CI-1 polyclonal antibody using the Custom pAb service offered by Genscript.
-
bioRxiv - Neuroscience 2022Quote: Mouse voltage-gated sodium channel 5934 base pair-long genes (mSCN8AWT, mSCN8AK1425TAG, and mSCN8AK1546TAG were synthetized by GenScript (mSCN8A ...
-
bioRxiv - Biochemistry 2021Quote: ... The linear peptides DMT1-II550-568 (AQPELYLLNTMDADSLVSR) and palmitoylated CI-MPR2347-2375 with N-terminal di-lysine (KKSNVSYKYSKVNKEEETDENETEWLMEEIQ) were both synthesised by Genscript (USA).
-
bioRxiv - Immunology 2020Quote: A full-length nucleocapsid (N) phosphoprotein nucleotide sequence (1293 base-pairs) of the SARS-CoV-2 virus was optimized and synthesized (Genscript). The synthesized sequence was cloned into a PET-30a(+ ...
-
bioRxiv - Genomics 2022Quote: ... a 9 base pair(bp)’Spatial barcode A’,(3) a 12bp anchor sequence(/AmC6/CTACACGACGCTCTTCCGA-Spatial barcode A-ACTGGCCTGCGA) (Genscript). To enlarge the barcode pool ...
-
bioRxiv - Biochemistry 2024Quote: The peptidase activity of the 20S CP was measured using a pair of substrates: the tripeptide benzyloxycarbonyl-Val-Leu-Arg-7-amino-4-methylcoumarin (Z-VLR-AMC, Genscript) and a 11-residue oligopeptide conjugated to 7-methoxycoumarin-4-acetic acid referred to as LF211 (7-methoxycoumarin4-acetic acid (MCA)-Lys-Lys-Val-Ala-Pro-Tyr-Pro-Met-Glu-(dinitrophenyl)diaminopropionyl-NH2 ...