Labshake search
Citations for Evrogen :
1 - 30 of 30 citations for TROP 2 Human 187a.a HEK293 His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biophysics 2021Quote: ... with the mutation C85A and C-terminal 6×His tag) was obtained as a synthetic gene from Evrogen (Russia) and introduced into the pET11 expression vector (Novagen ...
-
bioRxiv - Microbiology 2021Quote: ... 2 μl 10x Taq Turbo buffer (Evrogen), 0.25 mM dNTPs ...
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Biophysics 2019Quote: Monomeric photoswitchable cyan fluorescence protein 2 (PS-CFP2, Evrogen) was C-terminally equipped with an AVI-tag (GLNDIFEAQKIEWHE ...
-
bioRxiv - Immunology 2023Quote: Monomeric photoswitchable cyan fluorescence protein 2 (PS-CFP2, Evrogen) featuring an unpaired cysteine residue and C-terminally extended with an AVI-tag (GLNDIFEAQKIEWHE ...
-
bioRxiv - Genomics 2020Quote: ... was performed using the Trimmer-2 cDNA normalisation kit (Evrogen) following the manufacturer’s instructions ...
-
bioRxiv - Genomics 2023Quote: ... 2: rabbit anti-tRFP (1:1,000 dilution, polyclonal, Evrogen, AB233). The following secondary antibodies were used ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Cell Biology 2019Quote: ... or DMEMEGFP-2 anti-bleaching live cell visualization medium (Evrogen, #MCK02), both supplemented with 10% FBS and GlutaMAX-I (Gibco ...
-
bioRxiv - Cell Biology 2023Quote: ... medium was replaced with live-cell visualization medium DMEMgfp-2 (Evrogen) supplemented with 10 % FBS ...
-
bioRxiv - Neuroscience 2022Quote: ... All code for human 4R Tau amino acids 243 to 375 containing the mutations P301L and V337M fused to GFP or FR (Evrogen) with an 18-amino acid flexible linker (EFCSRRYRGPGIHRSPTA) ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Cell Biology 2021Quote: ... the medium was replaced by live-cell visualization medium DMEMgfp-2 (Evrogen) supplemented with 10% FBS and 2 mM L- glutamine ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Immunology 2021Quote: ... medium was replaced by live-cell visualization medium DMEMgfp-2 (Evrogen, cat. #MC102) supplemented with 10% FBS ...
-
bioRxiv - Immunology 2023Quote: ... medium was replaced by live-cell visualization medium DMEMgfp-2 (Evrogen, cat. #MC102) supplemented with 10% FBS ...
-
bioRxiv - Cell Biology 2019Quote: ... Media was exchanged to DMEMGFP-2 anti-bleaching live cell visualization medium (Evrogen # MCK02) supplemented with 10% FBS and GlutaMAX (Gibco #35050061 ...
-
bioRxiv - Molecular Biology 2021Quote: ... the resulting product was cleaned from 2% agarose gel by Cleanup Standard Kit (Evrogen), digested by MluI and HindIII and ligated into pMV306/MluI ...
-
bioRxiv - Cell Biology 2019Quote: ... Cells were imaged in DMEM gfp-2 anti-bleaching live-cell imaging medium (Evrogen) supplemented with 10% fetal bovine serum (FBS) ...
-
bioRxiv - Systems Biology 2019Quote: ... Tissue-specific cDNA libraries were created using the Mint-2 cDNA Synthesis Kit (Evrogen, Russia) according to the manufacturer’s instructions ...
-
bioRxiv - Cancer Biology 2023Quote: ... cDNA was generated from total RNA (2 μg) by using MMLV reverse transcriptase (Evrogen, Russia). Reverse transcription PCR reaction conditions were as follows ...
-
bioRxiv - Genomics 2023Quote: ... 100 ng of amplified products was mixed with 2 μL of 10X DSN buffer (Evrogen) and H2O to 20 μL ...
-
bioRxiv - Cancer Biology 2024Quote: ... 2 μg of total RNA and a reaction mixture with MMLV reverse transcriptase (Evrogen, Russia) were used ...
-
bioRxiv - Molecular Biology 2020Quote: ... The cDNA library was then normalized using the Trimmer-2 cDNA normalization kit (Evrogen, Moscow, Russia).
-
bioRxiv - Genomics 2023Quote: ... After 24-48 hours the coverslips were mounted in the GFP-imaging medium (DMEM-GFP-2, Evrogen) with rutin in a temperature-controlled chamber with CO2 and imaged on an inverted OMX Deltavision microscope in time-lapse mode ...
-
bioRxiv - Systems Biology 2020Quote: Cells were plated on 25 mm diameter coverslips (0.17 mm thick) in non-fluorescent media (DMEM gfp-2 with rutin; Evrogen). Coverslips were mounted in a temperature-controlled chamber with CO2 and imaged on an inverted OMXv3 Deltavision microscope in time-lapse mode ...
-
bioRxiv - Genomics 2020Quote: ... with cDNAs were incubated at 68 °C for 2 minutes before adding pre-warmed DSN buffer mix with 1 Units of DSN enzyme (Evrogen). The reaction then performed at 68 °C for 20 minutes ...
-
bioRxiv - Immunology 2021Quote: The RBD nucleotide sequence of SARS-CoV-2 Wuhan-Hu-1 isolate (Genbank accession number MN908947, from 319 to 545 aa) was synthesized (Evrogen, Russia) and cloned into the pCEP4 mammalian expression vector (Thermo Fisher Scientific ...
-
bioRxiv - Genomics 2023Quote: ... The libraries were sequenced on an Illumina NovaSeq 6000 platform (S Prime flow cell) with 2 × 150 bp paired-end reads (Evrogen Joint Stock Company, Russia).