Labshake search
Citations for Evrogen :
1 - 25 of 25 citations for Recombinant Rat Fc Fragment Of LgG Low Affinity IIb Receptor CD32 His tagged since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Developmental Biology 2023Quote: ... the TagCFP DNA fragment was amplified from pTagCFP-N (Evrogen) by PCR with the primers 5′-GAAGATCTATAACTTCGTATAGCATACATTATACGAAGTTATACCGGTCGCC ACCATGAGCG-3′ and 5′-CCGGAATTCCGGATCCATAACTTCGTATAATGTATGCTATACGAAGTTATACCACAACTAGAATGCAGTG-3′ ...
-
bioRxiv - Cell Biology 2021Quote: ... The fragment was purified using a Cleanup Standard kit (Evrogen, Russia), digested with EcoRI and KpnI enzymes (SibEnzyme ...
-
bioRxiv - Microbiology 2020Quote: ... The fragment encoding tagRFP was PCR-amplified from pTagRFP-N (Evrogen). The fragments of ftsZ ...
-
bioRxiv - Developmental Biology 2021Quote: ... Amplified fragments were cloned into the pAL-TA vector (Evrogen, Russia). Digoxygenine- labeled antisense RNA probes were generated from gene fragments ...
-
bioRxiv - Developmental Biology 2023Quote: ... Amplified fragments were cloned into the pAL-TA vector (Evrogen, Russia). Digoxygenine□labeled antisense RNA probes were generated from gene fragments ...
-
bioRxiv - Zoology 2023Quote: Amplified fragments were cloned into the pAL-TA vector (Evrogen, Russia). Digoxygenine-labeled antisense RNA probes were generated from gene fragments ...
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the pTurboGFP-C (Evrogen, FP511) or pKatushka2S-C (Evrogen ...
-
bioRxiv - Molecular Biology 2023Quote: ... PCR fragments were gel-extracted using the Cleanup Standard kit (Evrogen, BC04) and sequenced using were sequenced using NovaSeq 6000 with 300 paired-end cycles.
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the pFusionRed-C vector (Evrogen, FP411). The Cry2 fragment was amplified by PCR from the plasmid pHR-mCh-Cry2WT (Addgene ...
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into either the pTurboGFP-C (Evrogen, FP511) or pKatushka2S-C (Evrogen ...
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the FusionRed-C vector (Evrogen, FP411) linearized with XhoI ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Molecular Biology 2023Quote: ... The PCR fragments were gel-extracted using the Cleanup Standard kit (Evrogen, BC04) and sequenced using Illumina NextSeq ...
-
bioRxiv - Molecular Biology 2023Quote: ... The PCR fragments were gel-extracted using a Cleanup S-Cap kit (Evrogen, BC04). Next ...
-
bioRxiv - Biophysics 2021Quote: ... with the mutation C85A and C-terminal 6×His tag) was obtained as a synthetic gene from Evrogen (Russia) and introduced into the pET11 expression vector (Novagen ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... DNA fragments encoding M9M and Bimax2 peptides were inserted into the pTagRFP-C vector (Evrogen).
-
bioRxiv - Molecular Biology 2020Quote: ... mIBP83 fragment of pEX-A2-SBP-T plasmid was subcloned into pTagGFP2-N vector (Evrogen) by PCR with the primers
-
bioRxiv - Molecular Biology 2023Quote: ... Uncleaved DNA fragments were extracted from the gel using the Cleanup Standard kit (Evrogen, BC04). These fragments were used as the templates for two-step PCR ...
-
bioRxiv - Microbiology 2023Quote: ... Wells were screened by PCR for the presence of lysate with recombinant phages and T3Δ0.3 was further purified from individual plaques and verified by Sanger sequencing (Evrogen).
-
bioRxiv - Systems Biology 2019Quote: Total RNA was extracted from the tissue fragments isolated by laser microdissection using an ExtractRNA Kit (Evrogen, Russia) (for details ...
-
bioRxiv - Cell Biology 2021Quote: ... and 5’-ccgggggcggccgctcaaagcttacttttgttcatatgtttattcaatgca-3’ (for pMF1992)) and subcloning the BamHI/NotI-restricted PCR products into the BamHI/NotI-restricted backbone fragments of pKillerRed-dMito (Evrogen) (for pMF1991 ...
-
bioRxiv - Microbiology 2020Quote: The plasmid expressing phoP and phoQ was constructed by cloning the PCR fragment amplified with the Tersus DNA polymerase (Evrogen) and the phoPQf1 and phoPQr primers into the low copy number vector pZH449.
-
bioRxiv - Neuroscience 2020Quote: The caldendrin-tagRFP constructs were made by amplifying full length or caldendrin fragments from the pcDNA3.1/caldendrin vector and pasting them into the tagRFP-N plasmid (Evrogen, #FP142) using EcoRI and BamHI restriction and ligation.
-
bioRxiv - Neuroscience 2019Quote: ... They were then incubated with primary antibodies, rat monoclonal anti-GFP (Nacalai Tesque, GF090R) at 1:2000 and rabbit polyclonal anti-tRFP (Evrogen, AB233) at 1:2000 ...