Labshake search
Citations for Evrogen :
1 - 24 of 24 citations for Recombinant Human CSF1 Protein His Avi tagged Biotinylated since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biophysics 2021Quote: ... with the mutation C85A and C-terminal 6×His tag) was obtained as a synthetic gene from Evrogen (Russia) and introduced into the pET11 expression vector (Novagen ...
-
bioRxiv - Microbiology 2023Quote: ... Wells were screened by PCR for the presence of lysate with recombinant phages and T3Δ0.3 was further purified from individual plaques and verified by Sanger sequencing (Evrogen).
-
bioRxiv - Biochemistry 2019Quote: ... The mTagBFP (blue fluorescent protein, Evrogen) coding sequence was also amplified by PCR ...
-
bioRxiv - Neuroscience 2020Quote: ... Tag-blue fluorescent protein (Tag-BFP, Evrogen), Nlgn3Δ ...
-
bioRxiv - Biophysics 2019Quote: Monomeric photoswitchable cyan fluorescence protein 2 (PS-CFP2, Evrogen) was C-terminally equipped with an AVI-tag (GLNDIFEAQKIEWHE ...
-
bioRxiv - Immunology 2023Quote: Monomeric photoswitchable cyan fluorescence protein 2 (PS-CFP2, Evrogen) featuring an unpaired cysteine residue and C-terminally extended with an AVI-tag (GLNDIFEAQKIEWHE ...
-
bioRxiv - Cell Biology 2022Quote: ... Red fluorescent protein expression vector pTagRFP-N were from Evrogen, Moscow ...
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Cancer Biology 2023Quote: ... CT26 cells stably expressing near-infrared fluorescent protein eqFP650 (FP731, Evrogen) were injected subcutaneously into female Balb/c mice (12-14 weeks old ...
-
bioRxiv - Cell Biology 2022Quote: ... Protein samples were detected with 1:1000 diluted anti-RFP (AB233; Evrogen) for BORR:RFP detection and 1:2000 diluted anti-Histone H3 (ab1791 ...
-
bioRxiv - Pathology 2019Quote: ... The protein samples were detected with a polyclonal anti-tRFP antibody (Evrogen) for TagBFP ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Plant Biology 2021Quote: ... tagRFP fusion proteins were detected using the anti-tRFP (rabbit polyclonal, Evrogen AB233) diluted 1:5000 (v/v) ...
-
bioRxiv - Neuroscience 2022Quote: ... All code for human 4R Tau amino acids 243 to 375 containing the mutations P301L and V337M fused to GFP or FR (Evrogen) with an 18-amino acid flexible linker (EFCSRRYRGPGIHRSPTA) ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Cell Biology 2020Quote: ... we PCR amplified the coding region of the far-red fluores-cent protein turboFP635 (Evrogen) using primer sequences 5’-TGTACCGGTCTCGAGGCCACCAT-GGTGGGTGAGG and 5’-AGATCCGGAGCTGTG-CCCCAGTTTGCTA ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... Each variant contained a segmentation cassette that expressed both a TagBFP protein (Evrogen, Moscow, Russia) and a nuclear-localized TagBFP protein ...
-
Molecular coevolution of nuclear and nucleolar localization signals inside basic domain of HIV-1 TatbioRxiv - Evolutionary Biology 2021Quote: ... and cloned into a promoter-less vector encoding the red fluorescent protein TurboRFP (pTurboRFP-PRL; Evrogen, Moscow, Russia). U2OS cells were cotransfected with the EGFP-Tat ...
-
bioRxiv - Molecular Biology 2021Quote: A mouse codon-optimized version of the piggyBac transposase (PBase) was cloned in frame with the red fluorescent protein tagRFPt (Evrogen) into a pBroad3 vector (pBroad3_hyPBase_IRES_tagRFPt ...
-
bioRxiv - Neuroscience 2023Quote: ... was used to visualize LC neurons and rabbit anti-red fluorescent protein to visualise the fRed tag (tRFP, 1:1000, Evrogen). For visualisation of GRABNE2m expression in the hippocampus ...
-
bioRxiv - Physiology 2023Quote: ... with 1% beta-mercaptoethanol in a 1.5-ml tube using a polypropylene pestle and a drill and then incubated (55 °C, 10 min) with protein kinase K (Evrogen, Russia). Total RNA was extracted by a silica spin column (CleanRNA Standard ...
-
bioRxiv - Molecular Biology 2023Quote: ... into enhanced Piggybac (ePB) doxycycline-inducible expression vectors.46 Overlap PCR constructs encoding FLAG-APEX2 fusions with mKate2 fluorescent protein (Evrogen, cat. #FP181) were cloned between BamHI and NotI sites in ePB vectors as follows ...