Labshake search
Citations for Evrogen :
1 - 33 of 33 citations for Recombinant Human C mer Proto Oncogene Tyrosine Kinase since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Physiology 2023Quote: ... with 1% beta-mercaptoethanol in a 1.5-ml tube using a polypropylene pestle and a drill and then incubated (55 °C, 10 min) with protein kinase K (Evrogen, Russia). Total RNA was extracted by a silica spin column (CleanRNA Standard ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Cell Biology 2021Quote: ... pDendra2-C vector (Evrogen) was modified ...
-
bioRxiv - Cell Biology 2019Quote: ... pTagGFP2-C (FP191, Evrogen) and pcDNA3.1 mycBioID (gift from Kyle Roux (Roux et al. ...
-
bioRxiv - Cell Biology 2020Quote: ... and pTagRFP-C (Evrogen) as above ...
-
bioRxiv - Biochemistry 2020Quote: pTagBFP-C (Evrogen, Moscow, RU) was used to generate the expression constructs of Rab5 and EHD2 wt or I157Q ...
-
bioRxiv - Cell Biology 2022Quote: ... pTagRFP-C (#FP141) from Evrogen, fura-2-AM ...
-
bioRxiv - Cell Biology 2024Quote: ... or pKatushka2S-C (Evrogen, FP761) vectors using BglII/BamHI restriction/ligation.
-
bioRxiv - Cell Biology 2024Quote: ... or pKatushka2S-C (Evrogen, FP761) vectors using BglII/BamHI restriction/ligation.
-
bioRxiv - Microbiology 2022Quote: ... 200 ng of plasmid pTagRFP-C (Evrogen), which expresses TagRFP from a CMV promoter ...
-
bioRxiv - Microbiology 2023Quote: ... Wells were screened by PCR for the presence of lysate with recombinant phages and T3Δ0.3 was further purified from individual plaques and verified by Sanger sequencing (Evrogen).
-
bioRxiv - Cell Biology 2022Quote: ... and inserted into the pTagBFP-C (Evrogen, Moscow, RU) expression vector.
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the pTurboGFP-C (Evrogen, FP511) or pKatushka2S-C (Evrogen ...
-
bioRxiv - Genetics 2022Quote: ... The 750 bp TagYFP coding sequence was amplified from pTagYFP-C (Evrogen) using primer pairs P3-TagYFP F1 and TagYFP 3R1:
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the pFusionRed-C vector (Evrogen, FP411). The Cry2 fragment was amplified by PCR from the plasmid pHR-mCh-Cry2WT (Addgene ...
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into either the pTurboGFP-C (Evrogen, FP511) or pKatushka2S-C (Evrogen ...
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the FusionRed-C vector (Evrogen, FP411) linearized with XhoI ...
-
bioRxiv - Cell Biology 2022Quote: ... TagRFP-FYVE(EE1A) was subcloned from pRS424GFP-FYVE(EEA1) into pTagRFP-C (Evrogen) and pEGFP-C1 (Clontech ...
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Cancer Biology 2019Quote: ... Expression constructs were created on the basis of vectors: pTagGFP2-C (#FF191, Evrogen, Russia). Sequencing was performed by the Sanger’s method (Evrogen ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... DNA fragments encoding M9M and Bimax2 peptides were inserted into the pTagRFP-C vector (Evrogen).
-
bioRxiv - Neuroscience 2019Quote: ... the mRit2 coding region was PCR-amplified and subcloned in-frame into the pTagRFP-C vector (Evrogen) at HindIII/XbaI sites ...
-
bioRxiv - Neuroscience 2020Quote: ... (ii) the same solution containing the primary antibody overnight at 4°C (anti-tRFP, 1:1000, Evrogen; anti-GABA ...
-
bioRxiv - Cell Biology 2023Quote: ... and anti-Tag(CGY)FP (1:2000 in 0.5% milk TBST, 4°C o/n, Evrogen AB121). Blots were then incubated with IRDye 800/680 conjugated antibodies (1:10000 in 5% milk TBST ...
-
bioRxiv - Neuroscience 2022Quote: ... All code for human 4R Tau amino acids 243 to 375 containing the mutations P301L and V337M fused to GFP or FR (Evrogen) with an 18-amino acid flexible linker (EFCSRRYRGPGIHRSPTA) ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Biophysics 2021Quote: ... with the mutation C85A and C-terminal 6×His tag) was obtained as a synthetic gene from Evrogen (Russia) and introduced into the pET11 expression vector (Novagen ...
-
bioRxiv - Biochemistry 2020Quote: HT1080 cells were plated in wells of Lab-Tek II chamber and co-transfected with pTwist-EF1a-nCoV-2019-S-2xStrep and pTagGFP2-C (Evrogen) plasmids ...
-
bioRxiv - Genomics 2020Quote: ... with cDNAs were incubated at 68 °C for 2 minutes before adding pre-warmed DSN buffer mix with 1 Units of DSN enzyme (Evrogen). The reaction then performed at 68 °C for 20 minutes ...
-
bioRxiv - Microbiology 2020Quote: ... The fixed cells were harvested (8000 g, 5 min, 4 °C) and resuspended in 1 mL of ExtractRNA Reagent (Evrogen, Russia) and the subsequent procedures were performed according to manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2021Quote: ... Blots were incubated overnight at 4°C with primary antibodies targeting Tag(CGY)FP (1:2000 dilution in 1% milk, Evrogen, Cat#: AB121), HaloTag (1:1000 dilution in 0.5% milk ...